KEGG   Bordetella holmesii ATCC 51541: D560_1138Help
Entry
D560_1138         CDS       T03052                                 

Gene name
thiC
Definition
(GenBank) thiamine biosynthesis protein ThiC
  KO
K03147  phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00730  Thiamine metabolism
bho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    D560_1138 (thiC)
Enzymes [BR:bho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     D560_1138 (thiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ThiC_Rad_SAM ThiC-associated
Motif
Other DBs
NCBI-ProteinID: AHV91631
Position
1078294..1080207
Genome map
AA seq 637 aa AA seqDB search
MNANPKFLAATAEVDAAAVAPLPKSRKIYEIGSRPDIRVPFREIEQHDTPTMFGGEHNPP
LTVYDTSGPYTDPQVTIDIRRGLQELRRGWIDERGDVEVLDGPSSEYGRGRLEDPKLTAM
RFDLRRPPRRAKTGANVTQMHYARRGIVTPEMEYVAIRESLRREHYLESLRASGPEGEKM
ARRLMRQHPGQSFGAAIPKAITAEFVRDEIARGRAIIPANINHPEVEPMIIGRNFLVKIN
ANIGNSAVSSGIGEEVEKMTWAIRWGGDTVMDLSTGKHIHETREWIIRNSPVPIGAVPIY
QALEKVDGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVRLPFIPMTADRMTGIVSRGGS
IIAKWCLAHNKESFLYERFEEICEIMKAYDVSFSLGDGLRPGSGYDANDEAQFAELKTLG
ELTQVAWKHDVQVMIEGPGHVPMQMIKENMELQLEHCHEAPFYTLGPLTTDIAPGYDHIT
SGIGAAIIGWYGTAMLCYVTPKEHLGLPNKKDVKDGIITYKIAAHAADLAKGHPGAAVRD
NALSKARFEFRWDDQFNLGLDPDTAREFHDETLPKDSMKVAHFCSMCGPHFCSMKITQDV
REYAASQGLSEQQALSQGMQEKAIEFVKKGAEVYHRN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccaacccgaagttcctggccgccacggccgaggtcgacgccgcggccgtcgcc
ccgcttcccaaatcccgcaaaatctacgaaatcggctcgcggcccgatattcgcgtgcct
tttcgcgaaatcgagcagcacgacacgcctacgatgttcggtggcgagcacaacccgccc
ctgaccgtctacgacaccagcggcccctacaccgacccgcaggtcacgatcgacatccgc
cgcggcctgcaagaactgcgccgcggctggatcgacgagcgtggcgacgtggaggtcctc
gacggcccgagcagtgaatatggccgcggccgcctggaagaccccaaactgacggcgatg
cgtttcgatttgcgccgcccgccgcgccgcgccaaaaccggcgccaacgtcacgcagatg
cattacgcccgccgcggcatcgtcacgccagagatggagtacgttgccatccgcgagagt
ctgcgccgcgaacactatctggagtcgctgcgcgccagcggccccgagggtgagaaaatg
gcccgccgcctgatgcgccaacacccggggcagtcatttggcgccgcgatcccgaaggcc
atcaccgcggaattcgtacgcgacgaaatcgcgcgcggccgcgccatcatcccggccaat
atcaaccatccggaagtcgaaccgatgatcatcggacgcaacttcctggtcaagatcaat
gccaatatcggtaactcggcggtcagttcgggcatcggcgaagaggtcgaaaaaatgacc
tgggccatccgctggggcggcgataccgtcatggacctgtccaccggcaagcacatccac
gagacacgcgaatggatcattcgcaattcgcccgtgcccatcggtgccgtgcccatctac
caggcgctggaaaaagtcgacggcaaggccgaagacctgacctgggagattttccgcgac
acgctgatcgagcaggccgaacaaggggtggactacttcactatccacgccggcgtccgc
ctgcccttcatccccatgacggccgaccgcatgacgggcatcgtctcgcggggcggctcc
atcattgccaagtggtgtctggcgcacaacaaggagagcttcctctatgagcgtttcgag
gaaatctgcgaaatcatgaaggcctatgacgtgagcttctcgcttggcgacggcttgcgc
cccggctcggggtatgacgccaatgacgaggcgcagttcgccgaactcaagacgctgggc
gagctgactcaggtcgcctggaagcacgacgtgcaggtcatgatcgaaggcccgggccac
gtgcccatgcagatgatcaaagaaaacatggagctgcagctcgaacactgtcacgaggcg
ccgttctacacgctcggcccgctgaccaccgacatcgctccgggctacgaccacatcacc
tcgggcatcggcgcggcgatcatcggctggtatggcacggccatgctctgctacgtcacc
cccaaggagcacctgggcctgcccaataaaaaggacgtcaaggacggcatcatcacctac
aagattgccgcccacgccgccgacctggccaagggccatccgggtgcggccgtgcgcgac
aacgcgctgtcgaaggcacgctttgaattccgctgggacgatcagttcaatctcgggctg
gatccggacaccgcgcgggagttccacgacgagacgctgcccaaagactcgatgaaggtg
gcgcacttctgctcgatgtgcggcccgcatttctgcagcatgaagatcactcaggacgtg
cgcgaatacgccgcgagccaaggtctgtcggagcaacaggccttgagtcaaggcatgcag
gaaaaagccatcgagttcgtgaaaaaaggtgcagaggtctatcaccgcaactaa

DBGET integrated database retrieval system