KEGG   Bordetella holmesii ATCC 51541: D560_1148Help
Entry
D560_1148         CDS       T03052                                 

Definition
(GenBank) rhodanese-like domain protein
Organism
bho  Bordetella holmesii ATCC 51541
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: AHV92528
Position
1090782..1091204
Genome map
AA seq 140 aa AA seqDB search
MDFLQFLLDKNNIFIVVVALASGAMLLVSGLRKGRGGSAVDTTTAIQMVNHQNAVWVDVR
AAEQFQAGHIAQARSVPADDLEKKAAALPKNKPLILVCEQGRTSPRIAQRLKALGLTDVK
TLDGGMRAWYAANLPVTQKG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggattttctgcaatttttgctcgataagaacaatattttcatcgtcgtcgtggcgctg
gcctccggcgccatgcttctggtcagtggtttgcgcaagggccgtggcggctcggcagtc
gataccaccacggcgattcagatggtcaaccaccaaaacgccgtctgggtggacgtgcgg
gcggccgagcagttccaggccggccacatcgctcaagcgcgcagcgtgccggccgatgac
ctcgaaaagaaagccgccgccttgcccaagaacaagccgctcatcctggtctgcgaacag
ggccgtacctcgccgcgcatcgcccagcgcctcaaggccctgggtctgaccgacgtcaag
acactcgacggcggcatgcgcgcctggtacgccgccaacctgcccgtcacccagaaaggc
tga

DBGET integrated database retrieval system