KEGG   Bordetella holmesii ATCC 51541: D560_1162Help
Entry
D560_1162         CDS       T03052                                 

Definition
(GenBank) hypothetical protein
Organism
bho  Bordetella holmesii ATCC 51541
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4390 DUF945
Motif
Other DBs
NCBI-ProteinID: AHV93394
Position
complement(1103725..1104309)
Genome map
AA seq 194 aa AA seqDB search
MIVRLIVAFLLAIAPFWFGEGGRAFASEPAVETIDPIIQDGRLAINADVDFPLNDQLRDA
AQRGLPLYFTADIQITKARWWWFDRSLVDTSMTWRVSYNALTRQWRVGQGELSLNVASLD
DAMDVVRRIRDWRLADSSEFEAGEVYTGQLRVRLDTSLLARPFQVNALNSSAWAASTPWR
EFSFTLTAPARDPS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcgtctaattgtcgccttcttgttggctatcgcccctttttggtttggagag
ggagggcgggcattcgcctccgaaccggcggtcgagacaatagacccgatcattcaggac
gggcggctggccattaatgcggatgtcgacttccccctcaatgaccagctgcgcgatgcc
gcgcagcgcggtctgcctttgtatttcacggcggacattcagataaccaaggcgcgttgg
tggtggtttgaccgcagcctggtcgacaccagcatgacctggcgggtgagctacaacgcc
ctcacgcgccagtggcgcgtggggcagggtgagctctccctgaacgtggcctcgcttgac
gatgccatggatgtcgtcagacggatccgtgattggcgcctggctgactcctccgagttc
gaggcgggcgaggtgtataccggtcagctacgcgtgcgtctggatacgtccttgctggcg
cgtccgtttcaggtcaatgcgttgaacagcagcgcctgggctgcctcgacgccttggcgg
gagttctccttcaccctcaccgcgcccgcgcgggatccctcatga

DBGET integrated database retrieval system