KEGG   Bordetella holmesii ATCC 51541: D560_1212Help
Entry
D560_1212         CDS       T03052                                 

Definition
(GenBank) cyclic nucleotide-binding domain protein
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho02020  Two-component system
bho02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bho00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D560_1212
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    D560_1212
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bho03000]
    D560_1212
Transcription factors [BR:bho03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    D560_1212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_Crp_2 cNMP_binding MarR_2 TrmB Phage_capsid HTH_20
Motif
Other DBs
NCBI-ProteinID: AHV92139
Position
complement(1151391..1151933)
Genome map
AA seq 180 aa AA seqDB search
MLSGLVKVSVGNAEGKVASLTGVPAGGWIGEGSLLKREVRKYDVVALRDSVVARLPAATF
DWLLDTSIPFNRYLLHQLNERVAQFIGKAEHDRLLDPDARVARCLAELFNPLLYPGMGMR
LAITQEEVGYLARVSRQRANQALGKLEEAGLLKVEYGAVRVMDLDGLKRYGADAAAVDEE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgctttccggcttggtgaaagtatcggtaggcaatgccgagggcaaggtcgcctcgttg
accggggtgccagccgggggctggataggcgagggttccctgctcaaacgcgaggttcgc
aaatacgatgtggtggcattgcgtgactcggtggtggcgcgcttgcccgcggcgaccttc
gactggctgcttgacaccagcatccccttcaatcgttatctgctgcaccaactcaatgag
cgcgtggcgcagttcatcggcaaggccgaacacgacaggttgctggatccggacgcccgg
gtggcccgctgcctggccgaactgttcaaccctttgttgtaccccggcatgggcatgcgc
ctggccatcacgcaggaagaggtcggctatctggcgcgcgtctcacggcagcgcgccaat
caggccctcggaaaactcgaagaggcaggactgctgaaagtagagtatggcgcggtgcgc
gtgatggatctggatggcttgaagcgctatggtgcggatgccgcggccgtcgatgaagag
taa

DBGET integrated database retrieval system