KEGG   Bordetella holmesii ATCC 51541: D560_2243Help
Entry
D560_2243         CDS       T03052                                 

Gene name
ompR
Definition
(GenBank) transcriptional regulatory protein ompR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bho00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D560_2243 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bho02022]
    D560_2243 (ompR)
Two-component system [BR:bho02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   D560_2243 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AHV92087
Position
complement(2095867..2096601)
Genome map
AA seq 244 aa AA seqDB search
MNTQNTTPTRKILVVDDDPRLRDLLRRYLSEQGFNVFVAEDAKEMGKLWQREHFDLLVLD
LMLPGEDGLSICRRLRGGHDNTPIIMLTAKAEEIDRIVGLEMGADDYLSKPFNPRELLAR
INAILRRRGTEEHPGAPSQENESIAFGPYVLNLSTRTLTRNGEQVPITTGEFSVLKVFAR
HPKIPLSRDKLMELARGREYEAFDRSLDVQISRLRKLIESNPSKPVFIQTVWGLGYVFVP
DGGS
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatacgcaaaacaccacccccacccgcaagatcctggttgtcgacgatgatccgcgc
ctgcgcgatctgctgcgccgctacctgtcggaacaagggttcaatgtcttcgttgccgag
gatgccaaggaaatgggcaagctctggcagcgtgagcactttgacctgctcgtcctcgat
ttgatgcttccgggcgaggatggtctgtcgatctgccgacggctgcggggcggccacgac
aatacacccatcatcatgctgaccgccaaggccgaagagatcgaccgtatcgtcggcctt
gaaatgggcgctgacgactacttgtccaagcctttcaacccgcgagagctgctggcccgc
atcaatgcgatcctgcgccgccgtggcacggaagagcatccgggcgctcccagccaggag
aacgagtcgattgctttcgggccctatgtgctcaacctgtcgacccgcacccttacccgc
aatggcgagcaggtgcccatcaccaccggcgagttctcggtcctgaaggtctttgcccgc
caccccaagatcccactgtcgcgcgacaagctcatggagctggcccgcggccgcgagtac
gaggcgttcgaccgcagcctggacgtgcagatttcgcgtttgcgcaaactgatcgaatcc
aatccgtctaaacccgtcttcattcaaaccgtttggggcttgggatatgtcttcgtcccg
gatggcggcagctga

DBGET integrated database retrieval system