KEGG   Bordetella holmesii ATCC 51541: D560_2350Help
Entry
D560_2350         CDS       T03052                                 

Definition
(GenBank) degT/DnrJ/EryC1/StrS aminotransferase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00260  Glycine, serine and threonine metabolism
bho01100  Metabolic pathways
bho01110  Biosynthesis of secondary metabolites
bho01120  Microbial metabolism in diverse environments
bho01130  Biosynthesis of antibiotics
bho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D560_2350
Enzymes [BR:bho01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     D560_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AHV92454
Position
2196329..2197342
Genome map
AA seq 337 aa AA seqDB search
MIDFRSDTVTRPSAAMLQAMTCAPVGDDVMGDDPTVVALQQAVAERADKEAGLFFPTGTQ
SNLAGIMAHCGRGDEYLVGQLAHTYKYEGGGAAVLGSIQPQPIEHDGDGSLPIAKLEAAV
KPVGDAHYARTRLLALENTFHGKVIRQPYILEATAFARSRGLGTHLDGARVFNASVASGL
ALSELCQPFDTVSICFSKGLGAPVGSVLVGSQALIEQARRWRKVLGGGMRQSGVLAAAAQ
YALEHNVARLAQDHEHASLLGQGLAQLPGVQVLSQSTNMVFVSVAPEHRSRLNQGLKEAG
ILMSAVYDGPVRLVTHLDISRQDIERALQVFARLLSA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgatagattttcgcagcgataccgtgacccgcccttcggcagccatgttgcaagccatg
acgtgtgcgcctgtgggcgatgacgtcatgggtgatgaccccactgtcgtggcgttgcag
caggccgtcgccgagcgcgcggacaaggaagcagggctgttctttccgaccggcacgcaa
agcaatctggccggcatcatggcgcattgcggacgcggcgatgagtacctggtcgggcaa
ttggcgcacacctacaaatacgaaggcgggggcgccgccgtgctgggcagtattcagccc
cagcccatcgagcacgacggcgacggctcgctgcccatcgccaagctggaagccgcggtc
aagccggtgggcgatgcgcactatgcgcgtacgcgcttgttggcgcttgaaaataccttc
cacggcaaagtcatccggcagccctatattctggaggcgactgcctttgcgcgcagccgg
gggctgggcacccatctggatggggcacgggtattcaacgccagcgtcgccagcggattg
gcgcttagcgagctctgtcagcctttcgatacggtctctatctgtttttccaaggggctg
ggtgcaccggtaggatcggtgctggtgggcagccaggcgctgatcgagcaggccaggcgt
tggcgcaaggtgctcggcggtggtatgcgccagtcaggggtcttggccgcagcggcgcag
tacgcacttgaacacaatgtggcgcgtctggcccaagaccacgagcacgcgagcctgttg
ggccaggggctggcgcaattgcctggcgtgcaggtgctgtcgcagagcaccaatatggtg
ttcgtgagtgttgctcccgaacaccgcagcaggctcaaccaaggcctgaaggaagcgggc
attctgatgagcgcggtctatgacgggccggtacgtctggtgacccatctcgatatttcc
cgccaggacatcgagcgcgcactgcaggtgtttgcccgcttgttgagcgcatga

DBGET integrated database retrieval system