KEGG   Bordetella holmesii ATCC 51541: D560_2811Help
Entry
D560_2811         CDS       T03052                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00071  Fatty acid degradation
bho00072  Synthesis and degradation of ketone bodies
bho00280  Valine, leucine and isoleucine degradation
bho00310  Lysine degradation
bho00362  Benzoate degradation
bho00380  Tryptophan metabolism
bho00620  Pyruvate metabolism
bho00630  Glyoxylate and dicarboxylate metabolism
bho00640  Propanoate metabolism
bho00650  Butanoate metabolism
bho00900  Terpenoid backbone biosynthesis
bho01100  Metabolic pathways
bho01110  Biosynthesis of secondary metabolites
bho01120  Microbial metabolism in diverse environments
bho01130  Biosynthesis of antibiotics
bho01200  Carbon metabolism
bho01212  Fatty acid metabolism
bho02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D560_2811
   00630 Glyoxylate and dicarboxylate metabolism
    D560_2811
   00640 Propanoate metabolism
    D560_2811
   00650 Butanoate metabolism
    D560_2811
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D560_2811
   00072 Synthesis and degradation of ketone bodies
    D560_2811
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D560_2811
   00310 Lysine degradation
    D560_2811
   00380 Tryptophan metabolism
    D560_2811
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D560_2811
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D560_2811
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D560_2811
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bho04147]
    D560_2811
Enzymes [BR:bho01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D560_2811
Exosome [BR:bho04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D560_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHV92172
Position
complement(2634656..2635948)
Genome map
AA seq 430 aa AA seqDB search
MPFEPIYVVDGARSPFLKTRTGPGPFAASDLALQAGRALLLRQPFTPADLDEVIIGCAAP
SPDEVNIGRVIGLRLGCGHRVPGWTVQRNCASGMQALDSAIANIQLGRSQLVLAGGTDAL
SRSPVLFSSEMASWLARWFAARSMGARLSLLGKLRLRYLAPVIGLLKGLTDPVVGLSMGQ
TAENLATRFGISRSMMDAYSARSHERALAAQQAGRLEEIQPLVDDSGKLYPTDDGVRADS
SVDKLARLKPVFDKPFGNVTAGNSSQVSDGAALVLLASEAAVRRWDLQPIGRILDSQWAG
LDPAQMGLGPVHAATPILQRHGLGLNDLDLWEINEAFAAQVLACLAAWQDDIYCNEHFGT
PAWGTLDPQRLNVDGGAIAIGHPVGASGARIVLHLLQALRARGKKRGMAAICIGGGQGGA
MLVETLEDAR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcctttcgaaccgatttacgtcgtcgacggtgcccgctcaccgtttctcaaaacccgc
accgggccagggccctttgctgcctcggatctggcgctgcaggcaggccgtgcattattg
ttgcggcaacccttcacccccgccgatctggacgaagtcatcatcggctgcgccgcgcca
tcacccgacgaggtcaatatcggccgggtcatcggtctgcgactgggctgcgggcatcgc
gtgcctggctggaccgtgcagcgcaattgcgcctccggaatgcaggccctcgacagcgcc
atcgccaacattcagttaggccgcagccaattggtgctggccggcggcaccgatgccttg
tcgcgctcccccgtgctgttttccagcgaaatggcgagctggctggcccgttggtttgcc
gcacgcagcatgggcgcacgcctgtccctgctgggcaagctgcgcttgcgctatctggca
ccggtgatcggactgctcaagggcctgaccgatccggtcgtcggactatccatgggccag
actgcagaaaatctcgccacacgctttggcatcagccgcagcatgatggatgcctattcg
gcgcgcagccatgagcgggcgctcgccgcgcagcaggccgggcggctggaggaaatccag
cccctggtcgacgacagcggcaaactctacccgaccgacgatggcgtgcgcgcggactcc
agtgtggacaagctcgcccggctcaaaccggtcttcgacaaaccgttcggcaacgtgaca
gcaggcaatagttcgcaggtcagcgatggggcggcactggttctgctggcttccgaggct
gcggtacggcgttgggatctgcagccaatcgggcgcattctggacagccaatgggctggc
ctcgatccagcccagatggggctgggaccggtacatgccgccacgcccatcctgcaacgt
catgggctgggactcaacgacctggacctctgggaaatcaacgaagccttcgccgcccag
gtgctggcgtgcctggccgcatggcaggacgacatctattgcaatgaacacttcggcacg
cccgcctggggcacgctggatccgcaacgcctgaatgtcgacggtggcgccatcgccatt
ggtcaccccgtcggcgcatcgggcgcgcgcattgtgctgcatcttctgcaggcattgcgc
gctcgcggaaaaaagcgtggcatggcggctatctgcataggtggcggacaaggcggagcc
atgctggttgaaactctggaggacgcacgatga

DBGET integrated database retrieval system