KEGG   Brachyspira hampsonii: BHAMNSH16_07340Help
Entry
BHAMNSH16_07340   CDS       T05655                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bhp  Brachyspira hampsonii
Pathway
bhp00230  Purine metabolism
bhp00250  Alanine, aspartate and glutamate metabolism
bhp01100  Metabolic pathways
Module
bhp_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bhp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BHAMNSH16_07340
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BHAMNSH16_07340
Enzymes [BR:bhp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BHAMNSH16_07340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt Caenor_Her-1
Motif
Other DBs
NCBI-ProteinID: ASJ21463
UniProt: A0A1E5NMT5
Position
complement(1713888..1715171)
Genome map
AA seq 427 aa AA seqDB search
MASVIIVGTQWGDEGKGKIVDYLAENCEYVVRSQGGSNAGHTVVVDNVKYKLRLLPSGIL
YKDKVCVIGNGVVIEPKVFLGEIDALAEKKVNISNLKISNRAHVLMPYHRLLDELQEEDL
GENKLGTTKNGIGPCYMDKSSRLGIRIVDLMNKEVFAKKLKFNLELKNKLLKKVYNHDGF
DYDALLKEYLEYAERLKPYVADTTTILNKAIKEKKNILFEGAQATMLDLDHGTYPYVTSS
YPAAGGACTGSGVGPRKIDNVIGVVKAYSTRVGEGPFPSELHDDIGQAIRDKGGEYGTVT
GRPRRCGWLDACVVKYASYVNGLDSIAVTRLDILDDLDKLKICVAYKYNGEILEGYPADL
DILSKAEPVYEEFEGWKTSTREIREYDKLPENAKKYLKRLSEVIETDISIVSVGAGRDET
IIVKNIF
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagtaattatagtaggcactcaatggggtgatgagggcaaaggtaaaatagtg
gattatcttgccgaaaactgcgaatatgttgttcgttctcagggcggaagtaatgcaggt
cataccgttgtggtggataatgtgaaatataaattaagacttttaccttctggtatactt
tataaggataaagtttgcgttataggtaatggagttgttatagaacctaaagtttttttg
ggtgaaatagacgctcttgctgagaagaaagttaatatatctaatcttaaaatttctaac
agggctcatgtattaatgccttatcataggcttcttgatgaacttcaggaagaggatctt
ggagaaaataaattaggtactactaaaaacggtataggtccttgttatatggataaatcc
agccgtttgggtataagaatagttgatttgatgaataaagaagtttttgctaaaaaatta
aagtttaatcttgagcttaaaaataaactccttaaaaaagtttataatcatgacggattt
gattatgatgcacttttaaaagagtatttggaatatgctgagagattaaaaccttatgtc
gctgatactactacaatattaaataaagctattaaagagaaaaaaaatatattgtttgaa
ggagctcaggctactatgcttgacttggatcatggtacttatccttatgtaacatcatct
taccctgctgccggaggagcttgtactggttcaggtgtgggacctagaaagattgataat
gttataggagttgtaaaggcttattctactagagtgggagaaggacctttcccttcagag
cttcatgatgatataggacaggctataagagacaaaggcggagagtacggcactgttact
ggaagaccaagaagatgcggttggcttgatgcctgcgttgtaaaatatgcttcctatgtg
aacggacttgattctattgctgtaactaggcttgatatattagatgatttggataaatta
aaaatatgtgttgcctacaaatataatggtgagatattagaaggttatcctgcagatttg
gatatactttcaaaagctgagccagtgtatgaagagtttgaaggctggaaaactagcact
agagaaattagagaatatgataaacttccggaaaatgctaaaaagtatttaaaaagatta
agtgaagtaatagaaacagatatttctattgtttcagtaggagcaggaagagatgaaact
ataatcgttaaaaatattttttaa

DBGET integrated database retrieval system