KEGG   Borrelia hermsii DAH: BH0519AHelp
Entry
BH0519A           CDS       T00764                                 

Definition
(GenBank) glutathione peroxidase-like BsaA
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bhr  Borrelia hermsii DAH
Pathway
bhr00480  Glutathione metabolism
bhr00590  Arachidonic acid metabolism
bhr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BH0519A
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BH0519A
Enzymes [BR:bhr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BH0519A
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AAX17028
Position
537850..538332
Genome map
AA seq 160 aa AA seqDB search
MSVYGFRARLASGPEISLSDYIRKVLLIVNVASDCSYTNQYQDLEVLYKIYKRRGFLILG
FPCNQFGFQEPGSNNEILKFCRTVYNVSFPIFSKIDVNGENAHPLYRYLREKSPEEFKGD
IRWNFTKFLINREGNVVGRYTPKIAPIKMKDDIEKWLSVI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgtatggttttagagcaaggcttgcatcagggcctgaaatttctctttcagat
tatattcgaaaagtattgcttatagttaatgtggcaagtgattgtagttatacaaatcaa
tatcaggatttggaagtgctttacaagatatataaacggcgggggtttttaatattggga
tttccttgtaatcagtttggatttcaggagcctggatcaaataatgagattttaaaattt
tgtcggacagtttataatgtctcatttcctattttttctaaaattgatgttaatggtgag
aatgcacatcctttatatagatatctaagagaaaaatctccagaggaatttaaaggagat
attcgttggaattttactaaatttttaataaaccgagaaggcaatgtggtaggtaggtat
actcctaagatagccccaattaaaatgaaagatgatattgagaaatggttaagtgtgatt
tag

DBGET integrated database retrieval system