KEGG   Borrelia hermsii DAH: BH0658Help
Entry
BH0658            CDS       T00764                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bhr  Borrelia hermsii DAH
Pathway
bhr00010  Glycolysis / Gluconeogenesis
bhr00260  Glycine, serine and threonine metabolism
bhr00680  Methane metabolism
bhr01100  Metabolic pathways
bhr01110  Biosynthesis of secondary metabolites
bhr01120  Microbial metabolism in diverse environments
bhr01130  Biosynthesis of antibiotics
bhr01200  Carbon metabolism
bhr01230  Biosynthesis of amino acids
Module
bhr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bhr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH0658
  Energy metabolism
   00680 Methane metabolism
    BH0658
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH0658
Enzymes [BR:bhr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BH0658
Membrane trafficking [BR:bhr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BH0658
Exosome [BR:bhr04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BH0658
  Exosomal proteins of melanoma cells
   BH0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF134
Motif
Other DBs
NCBI-ProteinID: AAX17157
UniProt: B2S101
Position
703816..704562
Genome map
AA seq 248 aa AA seqDB search
MYKLVLVRHGESEWNRENLFTGWTDVKLSEKGISEALEGGRVLKQNGYSFDIAFSSMLVR
ANDTLNIILRELGQSYIDVEKSWRLNERHYGALQGLNKAETAEKYGEDQVLMWRRSYDIP
PMPLEESDKRHPIHDLRYKGIPKSELPSTECLKDTVARVIPYWTDKIAKAIIEGKRVIIA
AHGNSLRALVKYLDNMSDDDILKLNIPTGIPLVYELDQDLRPIKHYYLGDEDKIKAAMES
VANQGKKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtataaattagttttagtgaggcatggtgagagtgaatggaatagagaaaatcttttt
acaggctggactgatgttaagctttctgaaaagggtatttctgaagctttagagggtggt
agagttcttaaacaaaatggatattcttttgatattgcttttagttcaatgttagtcaga
gctaatgatactttaaatattattttgcgtgagttgggacaatcttatattgatgtagag
aaatcctggcgactcaatgagaggcattatggagctttgcaagggttaaataaggctgag
acagctgagaagtatggagaagatcaggttttaatgtggagacgtagttatgatattcct
cctatgcctttagaagagtctgataagcgtcatccaattcatgacttaagatataaagga
attcctaaaagtgagcttccctcaacagaatgtttaaaggatactgttgcaagagttata
ccgtattggacagataaaattgctaaagctattattgagggaaaaagagttattattgct
gctcatggtaattccttaagagctcttgttaaatatcttgataatatgagtgatgatgat
attttaaagctcaatattccgactggtattcctttagtttatgaacttgatcaagattta
agacctattaaacactattacttaggtgatgaggataagattaaggcggctatggaatct
gttgctaatcaaggaaagaaaaaataa

DBGET integrated database retrieval system