KEGG   Bartonella henselae BM1374165: BM1374165_00414Help
Entry
BM1374165_00414   CDS       T03309                                 

Gene name
dxs
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate synthase
  KO
K01662  1-deoxy-D-xylulose-5-phosphate synthase [EC:2.2.1.7]
Organism
bhs  Bartonella henselae BM1374165
Pathway
bhs00730  Thiamine metabolism
bhs00900  Terpenoid backbone biosynthesis
bhs01100  Metabolic pathways
bhs01110  Biosynthesis of secondary metabolites
bhs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bhs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BM1374165_00414 (dxs)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BM1374165_00414 (dxs)
Enzymes [BR:bhs01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.7  1-deoxy-D-xylulose-5-phosphate synthase
     BM1374165_00414 (dxs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_synthase_N Transket_pyr Transketolase_C E1_dh Transketolase_N TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: CDO46435
UniProt: X5LV38
Position
475319..477241
Genome map
AA seq 640 aa AA seqDB search
MSRTLTPLLDRVCEPQDLRAFPESDLARLADELRAETIDVVSVTGGHLGAGLGVIELTVA
LHYVFNTPEDRIIWDVGHQAYPHKILTGRREKIRTLRQEGGLSGFTKRSESVYDPFGAGH
SSTSISAGLGMAVASALKAEKRRNIVAVIGDGAMSAGMAYEAMNNAGALNARLIVVLNDN
DMSIAPPTGAMSAHLARLVSRPAYRSLRERVKVLGEKLPKFFLDKARRSEEFARGFLVGG
TLFEELGFYYVGPIDGHNLKHLLPVLKNVREYPTGPVLIHVVTHKGKGYAPAEASLDKYH
GVNRFDIITGKQVKASSNVLPYTKVFSKALREEASYDDKIVAITAAMPTGTGLDFFAEKF
PERMFDVGIAEQHAVTFAAGMACEGYKPFVAIYSTFLQRAYDQIIHDVSIQKLPVRFAID
RAGFVGADGATHAGSFDIVFLTTLPEFVVMAPSDEVELMHMVRTAAAYDQGPISFRYPRG
EGIGMDLPQRGEILEIGKGRILHEGNRIALVCFGTRISEVLVAADELSAEGLSTTVADAR
FAKPLDKDLMRRLAREHEVLVTIEEGAIGGFGAHLLQFLAQEGLLEHGLKVRTLKLPDEY
LNHGSQEKVLSRIGLDAVGIVNTVFSALGRKIRTVQRVRV
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
ttgtctcggacattgacgccattacttgatcgtgtttgtgaaccacaagatttgcgggca
tttcctgaatctgatttggcacggttagctgatgagttgcgtgcagaaacaattgatgtg
gtttccgtaacaggtggtcatcttggtgcaggacttggtgttattgagcttacagttgca
ttgcattatgtttttaatacccctgaggataggattatttgggatgttggtcatcaagct
tatccgcataaaattttaacgggacgtagagagaaaattcgcacattgcgtcaagagggg
ggattgtcaggttttacaaagcgttcagaaagtgtatatgatccatttggtgcagggcat
tcttctacttctatttcagcaggtcttggtatggcggtggcaagtgctttaaaagcagag
aaaagacgcaatattgttgctgtgattggtgatggcgctatgtctgctggtatggcctat
gaagcgatgaataacgctggtgctttaaatgcacgcttgattgttgttcttaatgataat
gatatgtctattgcaccacctacaggtgctatgagtgctcatcttgcacgattagtttct
cgtcccgcttaccgtagtttgcgtgaacgggtaaaggtgctaggtgaaaaattgcccaag
ttctttttagacaaagcacgtcgttcagaggaatttgcgcgtggttttttggttggagga
actttatttgaagagcttggcttttactatgttggaccaatagatggtcacaatttaaag
catttattgcctgttttaaagaatgttcgtgaatatcctacaggtcctgttttgatacat
gtagtcacgcataagggtaagggatatgcacctgcggaagcatcattggataaatatcat
ggtgttaatcgttttgatattataacaggtaaacaggttaaagcatcaagcaatgttctt
ccctatactaaagtattttctaaagctttaagagaagaagccagttatgatgataagatt
gttgctataacagcggcaatgccaactggaacgggtcttgattttttcgctgaaaaattt
cctgagagaatgtttgatgttggtatcgctgagcagcatgcagtaacttttgctgctgga
atggcctgtgaaggctataaaccttttgtcgcgatttattctacttttttacagcgcgct
tatgatcagattatccacgatgtatcgattcaaaagttgcctgtgcgttttgcgattgat
cgagctggctttgtaggtgcagatggtgcgacgcatgctggcagttttgatattgttttt
ttgactactcttcctgaatttgttgtcatggcgccttctgatgaggtggaactgatgcat
atggtacgtaccgctgcagcttatgatcaggggccaatttcttttcgttatccgcgtggt
gaaggcattggcatggatttaccgcagcgcggtgagatattagagattggcaaaggacgt
attctgcatgagggaaacaggatagctttggtttgttttggaacgcggatatcagaagtg
ttggtggctgctgatgagttgagtgctgaaggattgtctacgactgttgcagatgcacgg
tttgcgaagcccttagataaagatttgatgcgtcgtttagcacgtgagcatgaagtatta
gtgacaattgaagaaggtgcaataggcgggtttggagcgcacttattacagtttttggca
caagaagggcttttagaacatggtttgaaagttcgcacattaaaacttcctgatgaatat
ttgaatcatggttcacaagagaaagttctttcgcgtataggacttgatgctgttggtatt
gttaatacggttttttctgctttaggacgcaagattcggacagtgcagagagttcgagta
tga

DBGET integrated database retrieval system