KEGG   Bartonella henselae BM1374165: BM1374165_01662Help
Entry
BM1374165_01662   CDS       T03309                                 

Gene name
guA
Definition
(GenBank) glutamine amidotransferase
  KO
K01951  GMP synthase (glutamine-hydrolysing) [EC:6.3.5.2]
Organism
bhs  Bartonella henselae BM1374165
Pathway
bhs00230  Purine metabolism
bhs01100  Metabolic pathways
Module
bhs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bhs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BM1374165_01662 (guA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bhs01002]
    BM1374165_01662 (guA)
Enzymes [BR:bhs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.2  GMP synthase (glutamine-hydrolysing)
     BM1374165_01662 (guA)
Peptidases [BR:bhs01002]
 Cysteine Peptidases
  Family C26: gamma-glutamyl hydrolase family
   BM1374165_01662 (guA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 GATase_3 DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: CDO47635
UniProt: X5MIG3
Position
complement(1900514..1901260)
Genome map
AA seq 248 aa AA seqDB search
MFVMQRCPDKKQRKSKPRIAVVIHRQSTYIGRLGKFLQKSGFVLDIYRPILGQKLPNTLE
HYAGVVILGGLMSVNDKEAYIGEEIDWISLVLKENKPFLGICLGAQMLARNLGGRVCTRN
DGTVEVGWYPLEATPQGKALMKWPEMVYHFHDEGIYDLPKEATLLATGYTYPTQAFRYGK
NAWGLQFHAEFTRAMMRRLVVRSAQKLTEKGAQPASAHLKGRLIYDQALSRWFENALQKI
FCVSTVCV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtgatgcaaagatgtcctgataaaaagcaaagaaagagcaaaccaagaattgcc
gttgttattcatcgccaatctacctatattggtcgcttgggaaagtttttgcagaaaagt
ggttttgttcttgatatttaccgtcctattttagggcagaaacttcccaatacgttagag
cattatgctggtgtcgtcattttaggggggctcatgagtgtgaatgacaaggaagcctat
attggtgaggaaattgattggatttctttggtgttgaaagagaataagccttttttaggt
atttgtcttggggcacaaatgttagcacgaaatttaggcgggcgtgtttgtacaagaaat
gatggaaccgttgaagttggctggtatccgctggaagcgactccacaaggcaaggcattg
atgaagtggccggaaatggtttatcattttcatgatgaaggtatttatgatttacctaaa
gaggcaacgcttttggcaacgggttatacatatcctacacaagctttccgttatggaaaa
aatgcatggggcttgcaatttcatgctgaattcacacgggctatgatgcgacgtttggtt
gtgcgttcagcacaaaaattaactgaaaagggtgctcagccagcttctgcacatttgaaa
ggtcgtttaatctatgatcaggctttgagccgatggtttgaaaatgcattgcaaaaaatt
ttttgtgtatcaactgtgtgcgtgtga

DBGET integrated database retrieval system