KEGG   Butyrivibrio hungatei: bhn_I0035Help
Entry
bhn_I0035         CDS       T04542                                 

Definition
(GenBank) pseudouridine synthase RluA family
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bhu  Butyrivibrio hungatei
Brite
KEGG Orthology (KO) [BR:bhu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bhu03009]
    bhn_I0035
Enzymes [BR:bhu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     bhn_I0035
Ribosome biogenesis [BR:bhu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    bhn_I0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 BPS
Motif
Other DBs
NCBI-ProteinID: AOZ95071
UniProt: A0A1D9NY41
Position
I:37508..38197
Genome map
AA seq 229 aa AA seqDB search
MKRLEYIFEDKDIIVCHKPAGMATEGARAGQMDLVSSVRNYLARKDGSKSSKPPYVGTVY
RLDQPVEGVVVVCKTKQAASDLARQIKEHKTDKYYYAVCYGAVPEEKGHLSDYLIRNLDT
GLAEVTENTADAKKAELDYEVLWRKKGCTFLRIKLLTGRFHQIRVQMAHMGFPIVGDQKY
GNAESMGVSKELGLSNVCLCCYKFGFKHPVTKKKVSYEVEPEFLKSFDE
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
ttgaagcgtttggaatacatttttgaagacaaggatataatagtttgccacaagcctgca
ggaatggccacagaaggtgcaagagcaggccagatggaccttgtcagcagtgtgagaaat
tatcttgcaaggaaagatggatcaaagagctcaaagccgccctatgtaggtacggtttac
cggcttgatcagcccgtagaaggcgttgtggtagtatgcaagactaaacaggcagcttca
gatctagccaggcagataaaggaacacaaaacagataagtattactatgctgtttgctac
ggtgctgttcctgaagaaaagggccatttatcagactatctgatcagaaacttagatact
ggccttgctgaagtaactgagaatactgccgatgccaagaaagcagagcttgactacgaa
gtcctatggcgtaaaaaaggatgtacatttcttagaatcaagcttttaacagggcgtttt
caccagataagagttcagatggcgcatatgggatttcctatagttggagaccaaaagtac
ggaaatgcagaatctatgggcgtatccaaggaattaggcctatcaaatgtatgcctttgc
tgctacaaatttggctttaaacatccggtgaccaaaaagaaagtatcctatgaagttgaa
ccggaattcttaaaatcttttgatgaataa

DBGET integrated database retrieval system