KEGG   Butyrivibrio hungatei: bhn_I1152Help
Entry
bhn_I1152         CDS       T04542                                 

Definition
(GenBank) sodium ion-pumping decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
bhu  Butyrivibrio hungatei
Pathway
bhu00620  Pyruvate metabolism
bhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bhn_I1152
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bhu02000]
    bhn_I1152
Enzymes [BR:bhu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     bhn_I1152
Transporters [BR:bhu02000]
 Other transporters
  Primary active transporters [TC:3]
   bhn_I1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: AOZ96186
UniProt: A0A1D9P0M5
Position
I:1323184..1324596
Genome map
AA seq 470 aa AA seqDB search
MAELERKPVRINETVLRDAHQSLIATRMPTEVMLPIIDTMDKVGYNAVECWGGATFDACM
RFLKEDPWERLRQLRAGFKNTKLQMLLRGQNILGYKHYPDDVVEYFVQKSIANGIDIIRI
FDCLNDLRNLEASVKACKKEGGHAQIALAYTLGDAYTEEYWMNIAKDIESMGADSICIKD
MAGLLLPYEAEKLVKALKSATSLPIDLHTHYTSGVASMTYMKAAEAGVDIIDCAISPFAL
GTSQPATEVMVEAFKGQPFETGLDQKLLAKIADHFRPYREECLANGLMDPKVLGVNIKTL
MYQVPGGMLSNMVSQLKEQNASDKYDTVLEEIPQVRKDFGEPPLVTPSSQIVGTQAVMNV
LMGERYKVATDQTKDLLAGEYGKTIKPFNPEVQKKIIGDREVITCRPADKLQPGLDKFEK
EVSQWKQQDEDTLSYALFPQVATDFFKYRLAQQEKVDVSAADTKNGAYPV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattagagagaaaaccagttcgtatcaatgagactgttctgcgtgatgctcac
cagtcacttatcgcaacaagaatgcctactgaggttatgttgcctattattgatacaatg
gataaggttggatataacgcagtagagtgctggggcggtgctacatttgatgcttgcatg
agattccttaaagaggatccatgggagagacttcgtcagctccgtgcaggcttcaagaac
acaaagcttcagatgctccttcgtggacagaacatccttggatacaagcactatccagat
gatgtagttgagtactttgttcagaagtcaatcgcaaatggtattgatattatcagaatt
tttgactgtcttaacgaccttagaaaccttgaggcttcagttaaggcatgtaagaaagag
ggcggacacgctcagatcgctcttgcatacacacttggtgatgcttatacagaagagtac
tggatgaacatcgctaaagatatcgagtcaatgggtgcagattcaatctgtatcaaggat
atggctggacttcttcttccttacgaggcagagaagcttgttaaggctcttaagagtgct
acaagccttcctatcgatcttcacacacactacacttcaggtgttgccagcatgacatac
atgaaggcagctgaggctggtgttgatattatcgactgcgcaatttctccattcgctctt
ggtacatcacagcctgctactgaggttatggtagaagccttcaagggacagcctttcgag
actggtcttgatcagaagcttcttgctaagattgcagatcacttcagaccatacagagaa
gagtgccttgctaacggacttatggatcctaaggttcttggtgttaacatcaagactctt
atgtatcaggttcctggcggaatgctttctaacatggttagccagcttaaagagcagaat
gctagcgacaagtatgatacagttcttgaggagatcccacaggttcgtaaggactttggt
gagccacctcttgttacaccttcatcacagatcgttggtactcaggccgttatgaacgtt
cttatgggcgagagatacaaggttgctactgaccagactaaggacctccttgctggtgag
tatggtaagacaatcaagcctttcaacccagaagttcagaagaagatcattggtgataga
gaagttatcacatgcagaccagctgacaagttacagccaggtcttgataagttcgagaag
gaagtttcacagtggaagcagcaggatgaggatactctttcttatgcattgttcccacag
gttgctacagacttcttcaagtatcgtcttgcacagcaggaaaaagttgatgtttctgca
gcagatacaaagaacggagcttatcctgtttaa

DBGET integrated database retrieval system