KEGG   Butyrivibrio hungatei: bhn_I2130Help
Entry
bhn_I2130         CDS       T04542                                 

Definition
(GenBank) dihydrofolate reductase FolA
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
bhu  Butyrivibrio hungatei
Pathway
bhu00670  One carbon pool by folate
bhu00790  Folate biosynthesis
bhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    bhn_I2130
   00670 One carbon pool by folate
    bhn_I2130
Enzymes [BR:bhu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     bhn_I2130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AOZ97163
UniProt: A0A1D9P3T3
Position
I:complement(2428770..2429258)
Genome map
AA seq 162 aa AA seqDB search
MQAIVAVDSNWAIGNKGQLLVSIPADQKNFRNITMGKTIVYGRKTLETFPRQVVLPGRDN
IILSTREDYKVKDAAVAHSREELLQLVDDLDTNDVFIIGGERVYADFLDLCDTAIVTMID
KEYEADAYFPNLDEDPEWELADESEEQVYFDITYTYRTYKRK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaatcgtagcagtagacagcaattgggcaattggtaacaaaggacagctcctt
gtgagcattcctgctgaccaaaagaactttagaaatattacaatgggcaagacaatcgtt
tatggaagaaagactcttgaaactttcccaagacaggttgtgctcccaggaagagataat
atcattctttctacaagagaagattacaaggtaaaagatgcagctgttgcccacagcaga
gaagagctccttcagcttgtagatgatcttgataccaatgatgtattcatcatcggagga
gagagagtatacgcggatttccttgatctgtgcgatacagccatcgttacaatgatcgac
aaggaatacgaagcagatgcttacttcccaaatcttgatgaggaccctgagtgggagctt
gcagatgaaagcgaagagcaggtatattttgatattacctatacatatagaacttacaaa
cgcaaataa

DBGET integrated database retrieval system