KEGG   Butyrivibrio hungatei: bhn_I2226Help
Entry
bhn_I2226         CDS       T04542                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bhu  Butyrivibrio hungatei
Pathway
bhu00071  Fatty acid degradation
bhu00280  Valine, leucine and isoleucine degradation
bhu00310  Lysine degradation
bhu00362  Benzoate degradation
bhu00380  Tryptophan metabolism
bhu00620  Pyruvate metabolism
bhu00630  Glyoxylate and dicarboxylate metabolism
bhu00640  Propanoate metabolism
bhu00650  Butanoate metabolism
bhu00900  Terpenoid backbone biosynthesis
bhu01100  Metabolic pathways
bhu01110  Biosynthesis of secondary metabolites
bhu01120  Microbial metabolism in diverse environments
bhu01130  Biosynthesis of antibiotics
bhu01200  Carbon metabolism
bhu01212  Fatty acid metabolism
bhu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bhu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    bhn_I2226
   00630 Glyoxylate and dicarboxylate metabolism
    bhn_I2226
   00640 Propanoate metabolism
    bhn_I2226
   00650 Butanoate metabolism
    bhn_I2226
  09103 Lipid metabolism
   00071 Fatty acid degradation
    bhn_I2226
   00072 Synthesis and degradation of ketone bodies
    bhn_I2226
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    bhn_I2226
   00310 Lysine degradation
    bhn_I2226
   00380 Tryptophan metabolism
    bhn_I2226
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    bhn_I2226
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    bhn_I2226
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    bhn_I2226
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bhu04147]
    bhn_I2226
Enzymes [BR:bhu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     bhn_I2226
Exosome [BR:bhu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   bhn_I2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF1153 pXO2-72
Motif
Other DBs
NCBI-ProteinID: AOZ97259
UniProt: A0A1D9P412
Position
I:complement(2537331..2538521)
Genome map
AA seq 396 aa AA seqDB search
MAQKVVIAGAVRTAIGKMGGALSNTPAAELGSIVIKEALNRAGVKPEQVDEVLMGCVIQA
GLGQNVARQASIKAGLPIETPAVTLNVVCGSGLNCVNMAADLIKAGEADIVVAGGMENMS
MAPYALPNARFGYRMNNGTVVDTMVNDALTDAFNHYHMMITAENICDRWNLTREELDEFS
ANSQQKCEKAMAEGKFNDEIVPVPVKVKKEIVEFKTDEGPRAGTTAESLSKLKCCSGKEG
GLVTAGNASGINDGAAAVVVMSEEKAKELGIKPMATWVGGALAGVEPEIMGIGPVAATKK
VLNKTGLSLDNIDLIEANEAFAAQSVAVAKDLGFDMSKVNVNGGAIALGHPVGASGCRIL
VTLLHEMGRRADAKKGLATLCIGGGMGCATIVEKYE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaaagttgttatcgcaggtgctgttagaacagccattggtaagatgggtgga
gctctcagcaatactcctgcagcagaacttggatctattgttattaaggaggcacttaat
cgagctggtgtaaagcctgagcaggttgatgaagtccttatgggatgcgttattcaggca
ggtcttggacagaacgttgcaagacaggcatcaatcaaggcaggtcttccaatcgagact
cctgcagttacactcaacgtagtttgcggttctggtcttaactgtgtcaatatggcagct
gacctcattaaagcaggcgaggctgatatagttgtagctggtggtatggagaacatgtca
atggctccttacgcacttccaaatgcacgtttcggatatcgtatgaacaacggtacagtt
gtagatacaatggtaaacgatgctcttacagatgcattcaatcactatcacatgatgatc
acagcagagaatatctgcgacagatggaaccttacaagagaagagctcgatgagttctca
gctaattcacagcagaagtgtgaaaaggcaatggcagaaggtaagttcaacgatgagatc
gttcctgttcctgtaaaggttaagaaggaaatcgttgagttcaagacagacgagggtcct
cgtgctggcacaacagctgagagcctttcaaagcttaaatgctgctctggtaaagagggc
ggtcttgttacagctggtaacgcttcaggtatcaacgatggcgcagcagcagttgttgta
atgagcgaagagaaagctaaggaacttggaatcaagcctatggctacatgggtaggcgga
gcacttgctggtgttgagcctgagatcatgggtatcggacctgtagctgctacaaagaag
gttcttaataagactggtctttcacttgacaacatcgatcttatcgaggctaacgaggca
tttgcagctcagtcagttgcagttgctaaggaccttggattcgatatgagcaaggttaac
gttaacggtggtgctatcgcacttggacatccagttggagcttcaggatgccgtattctt
gttactcttcttcacgagatgggtagaagagctgatgctaagaagggtcttgcaactctt
tgcatcggtggcggaatgggctgcgctactattgtagagaaatatgagtga

DBGET integrated database retrieval system