KEGG   Butyrivibrio hungatei: bhn_I2627Help
Entry
bhn_I2627         CDS       T04542                                 

Definition
(GenBank) methionyl-tRNA synthetase MetG
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bhu  Butyrivibrio hungatei
Pathway
bhu00450  Selenocompound metabolism
bhu00970  Aminoacyl-tRNA biosynthesis
bhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    bhn_I2627
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    bhn_I2627
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bhu01007]
    bhn_I2627
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bhu03016]
    bhn_I2627
Enzymes [BR:bhu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     bhn_I2627
Amino acid related enzymes [BR:bhu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   bhn_I2627
Transfer RNA biogenesis [BR:bhu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    bhn_I2627
 Prokaryotic type
   Other AARSs
    bhn_I2627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1f Anticodon_1 tRNA-synt_1e DUF1272 DNA_ligase_ZBD tRNA-synt_1b
Motif
Other DBs
NCBI-ProteinID: AOZ97659
UniProt: A0A1D9P527
Position
I:complement(2984223..2986259)
Genome map
AA seq 678 aa AA seqDB search
MQNKGKYYITTAIAYTSGKPHIGNSYEIVLADAIARYKRKDGFDVHFQTGSDEHGQKIET
RAIEAGCNSPKEFVDQVSDTIKGLWNLMDTSYDKFIRTTDEDHVKQVQKIFKKFYDQGDI
YKGSYKGMYCTECEAFYTESQLVDGKCPECGGAVHPAEEEAYFFKMSKYADRLIEHINTH
PDFIQPVSRKNEMMNNFLLPGLQDLCVSRTSFKWGIPVDFDNKHVVYVWLDALTNYITGI
GYDADGNSSEEYKKWWPADLHLIGKDIIRFHTIYWPIFLFALGEPLPKQVFGHPWLLQGG
EKMSKSKGNVIYADDLVSLFGVDPVRYFVLHEMPFENDGVITWELLVERFNSDLANTLGN
LVNRTIAMSNKYLGGVVADKGVSEDVDADLKAVVSGCYEKVEAKMDELRVADALTEIFSL
FKRCNKYIDETEPWVLGKDESKKDRLSTVLYNLVEAISIGASLLEPFMPETAQKIKEQLS
TPDRDFDTLGQFGLCPNGTKVSESPEMLFARKDLKEVLEKSAEIVKKQKAEFEESQRKAA
ENLAKAGLAPAPVKKEESGEEKAPIDIPAKDEITYDQFGAMQFQVGEIIKCEAVENSKKL
LCSQVKIGSQVKQIVSGIRKYYSPEEMVGKKVMVLVNLKPAKLAGVMSEGMLLCAEDAEG
NLALMTPEKDMPAGAEIC
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacaagggaaaatattacattactactgcaattgcatatacatctggtaagcca
catatcggaaacagctatgagatcgtacttgcagatgcaatagcaagatataagagaaaa
gacggatttgatgtacatttccagactggttcagatgagcacggacagaagatcgagaca
cgtgctatcgaagctggctgtaattcaccaaaggaattcgtagatcaggtttcagatact
atcaaaggtctttggaacttgatggatacttcatatgataagttcattcgtactacagat
gaagatcatgttaagcaggttcagaagatcttcaagaagttctatgatcagggcgacatt
tataagggatcatacaaaggtatgtattgtacagagtgtgaggctttctatacagagtct
cagcttgttgatggcaagtgccctgagtgtggcggagcagttcatccagctgaagaggaa
gcttacttcttcaagatgagcaaatacgctgacagacttattgagcatatcaacacacat
cctgatttcattcagcctgtatccagaaagaacgagatgatgaacaacttccttcttcct
ggccttcaggatctttgtgtatcaagaacatcattcaagtggggaattccagttgatttt
gataacaagcatgtagtttatgtatggcttgatgctcttacaaactatatcacaggtatt
ggctatgatgcagatggcaacagctctgaggagtacaagaagtggtggccagctgatctt
caccttattggaaaagatattattcgtttccatacaatttattggccaatcttcctcttt
gctcttggcgagcctcttccaaagcaggtatttggacatccatggctcttacagggcggc
gagaagatgagtaaatcaaagggaaatgttatctatgctgatgatcttgtaagtctcttt
ggcgttgatcctgtcagatatttcgttcttcatgagatgccattcgaaaatgatggtgtt
atcacatgggaacttttagttgagagatttaactcagatcttgctaacacacttggtaac
cttgtaaatcgtactattgctatgagcaacaagtaccttggtggtgttgtggcagataag
ggtgtttctgaggatgtagatgcagaccttaaggcagttgtatctggctgctatgaaaag
gtagaagctaagatggatgagctcagagttgctgatgctcttacagagatcttttcactc
ttcaagagatgcaataagtatattgatgagacagagccttgggtacttggcaaggatgag
agcaagaaagacagactttcaacagttctttataaccttgtagaggcaatctcaatcggt
gcttcacttcttgagccattcatgccagaaacagcacagaagatcaaagagcagctttct
actccagatagagatttcgatacattaggtcagtttggcctttgcccaaatggcactaag
gtttcagagagcccagagatgctctttgctagaaaggacctcaaggaagtacttgagaag
tctgctgagatagttaaaaagcagaaggcagaatttgaagagtctcagagaaaagctgct
gagaaccttgcaaaggcaggacttgcaccagctccagtcaagaaggaagagtcaggagaa
gagaaggctcctatcgacattcctgcaaaggacgagatcacatatgatcagttcggggct
atgcagttccaggttggtgagatcattaagtgtgaggcggttgaaaattctaagaagctt
ctttgctcacaggttaagattggaagccaggtaaagcagatcgtttcaggaatcagaaag
tactattcacctgaagagatggtgggtaagaaggttatggtacttgtaaaccttaagcca
gctaagcttgcaggcgtaatgtctgagggaatgcttctttgtgctgaggatgctgagggc
aatcttgcacttatgactcctgaaaaagatatgccagcaggagcagaaatttgttaa

DBGET integrated database retrieval system