KEGG   Brachyspira hyodysenteriae WA1: BHWA1_01242Help
Entry
BHWA1_01242       CDS       T00865                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00010  Glycolysis / Gluconeogenesis
bhy00051  Fructose and mannose metabolism
bhy00562  Inositol phosphate metabolism
bhy01100  Metabolic pathways
bhy01110  Biosynthesis of secondary metabolites
bhy01120  Microbial metabolism in diverse environments
bhy01130  Biosynthesis of antibiotics
bhy01200  Carbon metabolism
bhy01230  Biosynthesis of amino acids
Module
bhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bhy_M00002  Glycolysis, core module involving three-carbon compounds
bhy_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BHWA1_01242 (tpiA)
   00051 Fructose and mannose metabolism
    BHWA1_01242 (tpiA)
   00562 Inositol phosphate metabolism
    BHWA1_01242 (tpiA)
Enzymes [BR:bhy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BHWA1_01242 (tpiA)
Exosome [BR:bhy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BHWA1_01242 (tpiA)
  Exosomal proteins of bladder cancer cells
   BHWA1_01242 (tpiA)
  Exosomal proteins of melanoma cells
   BHWA1_01242 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACN83721
UniProt: C0R0T3
Position
complement(1428423..1429184)
Genome map
AA seq 253 aa AA seqDB search
MARKKLIAGNWKMNNSNKEALELVNSLKGLVKDVKDRDIMIAPTFTCLSDVNNAIKGTNI
KLGAQNLYFEEKGAFTGQISADMLLAVGCEYVIIGHSECRDIFGEKDELINKKVKRALDK
NLIPVLCVGEHLEEREKGITSDIVSTQTKEAFKGLSEAEAKKVVIAYEPVWAIGTGKTAT
PQDADDVHKTIRETLKSLYNDSVAEGMIILYGGSVNEKNADDLLNMPNIDGALVGGASLV
ADKFARIVNYVAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaaaaaacttattgctggtaattggaaaatgaataattccaataaagaagct
ttagaattagttaatagtttgaagggcttagttaaagatgttaaagacagagatattatg
attgcacctacatttacttgtttaagtgatgttaataatgcaattaaaggaactaatatt
aaattaggtgctcagaatttatattttgaggaaaaaggtgctttcactggtcaaatttct
gccgacatgcttttagctgtaggatgtgagtatgttattataggacactctgaatgccgc
gatatatttggtgagaaagatgaacttataaataaaaaggtaaaaagagctttagataaa
aatcttattcctgttttatgtgtaggagaacatttagaagagagagaaaaaggtattact
tctgatatagtaagtactcaaactaaagaagcatttaaaggtttaagcgaagctgaggct
aaaaaagttgttatagcttatgaacctgtttgggctattggtacaggtaaaactgctact
cctcaggatgcagatgatgtacataaaactattagagaaactttgaaatctctttataat
gatagtgtagctgaaggtatgattatactttacggcggaagcgttaatgagaaaaatgct
gatgatttacttaatatgcctaatatagatggagcattagttggcggtgcatctttggtt
gctgataaatttgctagaatagttaattatgtagctaagtaa

DBGET integrated database retrieval system