KEGG   Brachyspira hyodysenteriae WA1: BHWA1_02172Help
Entry
BHWA1_02172       CDS       T00865                                 

Gene name
ipk
Definition
(GenBank) putative 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00900  Terpenoid backbone biosynthesis
bhy01100  Metabolic pathways
bhy01110  Biosynthesis of secondary metabolites
bhy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BHWA1_02172 (ipk)
Enzymes [BR:bhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     BHWA1_02172 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C SKA2
Motif
Other DBs
NCBI-ProteinID: ACN84630
UniProt: C0QW44
Position
2469896..2470750
Genome map
AA seq 284 aa AA seqDB search
MPIIKAPCKINISLDITSKRKDGYHLIESLFHTVNLYDIITIEKSDKYNITTSGKFALED
DKEENIVTKIFKHFQNNLNLSNNYNIHIEKNIPTGAGLGGGSSDAANIIKFFLSELNIDI
NDDLIESFSSFGADIPFFIRGGCAWVSGIGEKIQNYDFTLPYNVILIYPNIHVSTKLAYS
KFTPDDFNKSDLFYIKNMLDNKDIDFDKIVSKTYNVFEKNVFNLEKRIEEIKNKAESIIK
RKVTMSGSGSSLFVLYNNDDKNIEDDFQKLKNEFNIDIYKLSLI
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcctataataaaagctccatgcaaaataaatatttctcttgatataacatcaaaaaga
aaagacggatatcatttaatagaatctttatttcatacagttaatttatatgatattatc
actatcgaaaaatctgataaatataatattacaacaagcggtaaattcgcattagaagat
gataaagaagagaatattgtaacaaaaatattcaaacattttcaaaataacctgaatctt
agtaataattacaatatacatatagaaaaaaatatacctacaggggcaggacttggaggc
ggttcatctgatgctgctaatattattaagttttttttatcagaactaaatattgatata
aatgatgatttaatagaatctttttcttcatttggtgcggatattcctttttttattaga
ggaggctgtgcttgggtttcaggaattggcgagaaaatacaaaattatgattttaccctt
ccatataatgttattttaatatatccaaatatacatgtttctactaaattagcatattca
aagtttacccctgatgatttcaataaatctgatttattttatataaagaatatgcttgat
aataaagatattgattttgataaaatagtttcaaaaacatataatgtatttgagaagaat
gtttttaatttagaaaaaagaatagaagagataaaaaataaagcagaaagtataattaaa
agaaaagtaactatgagcggttcaggttcttcgctttttgttttatataataatgatgat
aaaaatatagaagatgattttcaaaaattaaaaaatgaatttaatattgatatatataaa
ttgagtttgatttaa

DBGET integrated database retrieval system