KEGG   Bordetella hinzii: ACR54_02367Help
Entry
ACR54_02367       CDS       T04004                                 

Gene name
fadA_3
Definition
(GenBank) Putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bhz  Bordetella hinzii
Pathway
bhz00071  Fatty acid degradation
bhz00072  Synthesis and degradation of ketone bodies
bhz00280  Valine, leucine and isoleucine degradation
bhz00310  Lysine degradation
bhz00362  Benzoate degradation
bhz00380  Tryptophan metabolism
bhz00620  Pyruvate metabolism
bhz00630  Glyoxylate and dicarboxylate metabolism
bhz00640  Propanoate metabolism
bhz00650  Butanoate metabolism
bhz00900  Terpenoid backbone biosynthesis
bhz01100  Metabolic pathways
bhz01110  Biosynthesis of secondary metabolites
bhz01120  Microbial metabolism in diverse environments
bhz01130  Biosynthesis of antibiotics
bhz01200  Carbon metabolism
bhz01212  Fatty acid metabolism
bhz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ACR54_02367 (fadA_3)
   00630 Glyoxylate and dicarboxylate metabolism
    ACR54_02367 (fadA_3)
   00640 Propanoate metabolism
    ACR54_02367 (fadA_3)
   00650 Butanoate metabolism
    ACR54_02367 (fadA_3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ACR54_02367 (fadA_3)
   00072 Synthesis and degradation of ketone bodies
    ACR54_02367 (fadA_3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ACR54_02367 (fadA_3)
   00310 Lysine degradation
    ACR54_02367 (fadA_3)
   00380 Tryptophan metabolism
    ACR54_02367 (fadA_3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ACR54_02367 (fadA_3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ACR54_02367 (fadA_3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACR54_02367 (fadA_3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bhz04147]
    ACR54_02367 (fadA_3)
Enzymes [BR:bhz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ACR54_02367 (fadA_3)
Exosome [BR:bhz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ACR54_02367 (fadA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AKQ55682
UniProt: A0A0H4WDN4
Position
2464341..2465555
Genome map
AA seq 404 aa AA seqDB search
MQAYIYDAVRTPRGRGKANGALHTLSPLELGATVLRAVPQRGGFAPQALDEVIFGCVEAV
DDQGANLARSAALAAGYGDSVPGFMVARFCGSALDAVNAAAAKVMAGQADGVVAGGVEMN
SLVPMLVGTGGPSVSDVFFNDLVLQTPQGVAADLIATLEGFGRDDVDAYAAASHARAARA
QREGWFEGSLVPVHDANGALMLAHDELVRPETTVQSLSQLKPSFAENGEKLGFDATVRYR
YARVDSIQHVHHAGNSSGIADGASAVLVGSAAFGKQAGLRPRARILATASAGADPCLMLT
APVPASQRCLARAGLTAADIDLFEVNEAFASVVLHYMRHMNIPQDKVNVAGGAIALGHPV
GATGGMLVGTVLDELERRGGHRALVTMCTGLGMAVATLIERVAQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcctatatctacgatgcggtgaggacgccccgggggcggggcaaggccaatggc
gccttgcatacattgtccccgctggaactcggcgcgaccgtgctgcgcgccgtgccgcaa
cgcggcggattcgcgccccaggcgctggacgaagtcatcttcggatgcgtagaggcggtc
gacgaccagggcgccaacctggcgcgctctgcggcgctggctgccggttatggcgacagc
gtgcccggtttcatggtcgcgcgcttctgcggctcggcgctggatgccgtgaatgccgcc
gccgccaaagtcatggccggacaggccgacggcgtggtcgccggaggcgtggagatgaac
tcgctggtgcccatgctggtgggaactggcgggccttcggtgagcgatgtgtttttcaat
gacctggtgctgcagaccccgcagggggtggccgccgacctgatcgccacgctggagggg
ttcgggcgcgacgatgtggacgcctatgcggcggcgtcgcatgcgcgcgcggcgcgcgcc
caacgcgaagggtggttcgaaggctcgctggtgcctgtccacgatgccaatggcgcgctc
atgctggcccatgacgagctggtgcgtccggagaccacggtgcaaagcctgtcccagctc
aaaccctcgtttgccgagaacggcgagaaactgggttttgacgccacggtgcgctatcgc
tatgcccgggtcgacagcatccagcatgtccatcatgcgggtaattcctcaggcatcgcc
gatggcgcctcggcggtgctggtgggcagcgcagccttcggcaaacaggccggcctacgt
ccgcgcgcgcgcatcctggccacggccagcgccggcgccgatccctgcctgatgctgacc
gcgcccgtgccggccagccagcgctgcctggcgcgcgccggactgacggcggcggacatc
gacctgttcgaggtcaatgaggccttcgcctccgtggtgctgcattacatgcggcacatg
aatatcccgcaagacaaggtcaatgtggccggaggcgcgatcgccctcggccatccggtg
ggagcgacgggcggcatgctggtcggcacggtgctggatgaactggagcgccgcggcggg
caccgggcgctggtgaccatgtgcaccggcctggggatggcggtggcgacgttgatcgag
cgcgtggcgcaataa

DBGET integrated database retrieval system