KEGG   Bordetella hinzii: ACR54_02490Help
Entry
ACR54_02490       CDS       T04004                                 

Definition
(GenBank) 2-oxoglutaramate amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
bhz  Bordetella hinzii
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACR54_02490
Enzymes [BR:bhz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     ACR54_02490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AKQ55805
UniProt: A0A0H4W0V0
Position
2585692..2586477
Genome map
AA seq 261 aa AA seqDB search
MKIAMGQFAVRPVWEENAAICRDLMQRARAGGADALVLPEGVLARDITDPDIVKRSAQPL
DGPFIAALLPATQGLTVFFCVHVPAADGKVWNTQLALRDGRIIAQYRKLHLYDAFNMQES
LNVLAGAEIPPLVEVAGLKVGMLTCYDLRFPELPRRLALDGADVLVAPSAWVRGPLKEMH
WQVLSQARALENTCYLVAVGECGPRNIGASMVIDPLGVIIARAAETDALVFADIDAARLA
QARLALPVLQNRRFARPELAA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccatggggcaattcgccgtccgccccgtctgggaagaaaacgccgccatc
tgccgcgacctgatgcagcgcgcccgcgccggcggcgccgacgccctggtcctgcccgaa
ggcgtgctggcccgcgacatcaccgacccggacatcgtcaagcgctcggcccagccgctg
gacggccccttcatcgccgcgctgctgcccgccacgcaaggcttgaccgtgttcttctgc
gtgcatgtgccggcggccgacggcaaggtctggaacacccagctggccttgcgcgacggc
cgcatcatcgcccaataccgcaagctgcatctctacgacgccttcaatatgcaggagtcg
ctcaatgtgctggccggcgccgagatcccgcccctggtcgaggtggccggcctgaaggtc
ggcatgctgacctgctatgacctgcgctttcccgagttgccgcgccgcctggcgctggat
ggcgccgacgtgctggtcgccccttcggcctgggtcaggggcccgctgaaagaaatgcac
tggcaggtgctctcgcaggcgcgcgcgctggagaacacctgctatctggtggctgtgggc
gaatgcggcccgcgcaacatcggcgccagcatggtcatcgacccgctgggcgtcatcatc
gcccgggcggccgagaccgatgccctggtctttgccgacattgacgcggcgcgcctggcg
caggcgcgcctggcgctgcccgtgctgcagaaccgccgcttcgcgcgtcccgaactggcc
gcctga

DBGET integrated database retrieval system