KEGG   Bordetella hinzii: ACR54_03675
Entry
ACR54_03675       CDS       T04004                                 

Gene name
fdhS
Definition
(GenBank) Fructose dehydrogenase small subunit precursor
  KO
K23274  fructose 5-dehydrogenase small subunit [EC:1.1.99.11]
Organism
bhz  Bordetella hinzii
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACR54_03675 (fdhS)
Enzymes [BR:bhz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.11  fructose 5-dehydrogenase
     ACR54_03675 (fdhS)
SSDB
Motif
Pfam: FAD-SLDH
Other DBs
NCBI-ProteinID: AKQ56965
UniProt: A0A0H4WLD2
Position
3851344..3851910
AA seq 188 aa
MELPDIPSGVPQARPRPSRQRRALLLGLAGVCVQTCLPGVAPAAPVADSAFLALSRVLTD
RQHLNPLTASRIQAALAGSGVRQAARLPELIALAASAADSAQLMQAARQAGLQDLAGDIV
AAWYTGTVGSGPAAVLVAYEEALMYQPVRDALTVPTYCSYGPMWWTAAPPDAAAMPPEPP
LLPTSKAL
NT seq 567 nt   +upstreamnt  +downstreamnt
ttggaactccccgatattccctctggcgtcccgcaagcgcggccccggccatcgcggcag
cggcgcgcactcttgctggggctcgccggcgtctgcgtgcaaacctgcctgccgggtgtc
gcccccgccgcccccgtggccgattccgccttcctcgccctgtcgcgcgtcctgacggac
cgccagcatctcaatcccttgaccgcctcccgcatccaggccgcgctggccggctcgggc
gtgcgccaggccgcccgcttgcccgagctcatcgcgctggccgcttcggccgccgacagc
gcgcaactgatgcaggcggcccgccaggccggcctgcaggatctcgccggcgacatcgtg
gcggcctggtacaccggcacggtgggctcgggaccggccgccgtgctggtggcctatgaa
gaagcgctgatgtaccagccggtgcgcgacgccctgaccgtgcccacctattgcagttac
ggccccatgtggtggacggccgccccgcccgatgcggccgcgatgccgcccgagcctcct
cttcttcccaccagcaaggcgctgtga

DBGET integrated database retrieval system