KEGG   Bordetella hinzii: ACR54_04290Help
Entry
ACR54_04290       CDS       T04004                                 

Gene name
metX
Definition
(GenBank) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
bhz  Bordetella hinzii
Pathway
bhz00270  Cysteine and methionine metabolism
bhz00920  Sulfur metabolism
bhz01100  Metabolic pathways
bhz01110  Biosynthesis of secondary metabolites
bhz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ACR54_04290 (metX)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ACR54_04290 (metX)
Enzymes [BR:bhz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     ACR54_04290 (metX)
    2.3.1.46  homoserine O-succinyltransferase
     ACR54_04290 (metX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Esterase
Motif
Other DBs
NCBI-ProteinID: AKQ57569
UniProt: A0A0H4W9H3
Position
complement(4541897..4543120)
Genome map
AA seq 407 aa AA seqDB search
MTSPAISAANAASPETPNSVGVVSPVFLRFDEPLPLASGQSLQAYELAVETYGTLNAERS
NAVLICHALNASHHVAGVASDNPKDIGWWDNMVGPGKPVDTNIFFVIGINNLGSCFGSTG
PASLNPATGQPWGAAFPVLTVEDWVRAQARVADHFGIQRFAAVMGGSLGGMQALSWSLTL
PERVAHCVVIASTPRLSAQNIGFNEVARRAIITDPDFHGGNYYAHNTVPRRGLAVARMIG
HITYLSDDDMAEKFGRTQREPAENGAYRYGYDVEFEVESYLRYQGEKFSRYFDANTYLLI
TRALDYFDPARDTGGDLARALSPATADFLLVSFTTDWRFPPERSRELVRGLLKNGSPVTY
AEIDAPHGHDAFLLEDARYHAVVRGYYERIARSLGLRSQQPAEECLA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaccagccctgctatttccgcggccaatgccgcgtcgcccgaaaccccgaattccgtc
ggggtcgtctctcctgtcttcttgcgcttcgatgagcccttgccgctggcaagcggccag
tcgctgcaggcctacgagctggcggtggaaacctacggcaccctgaatgccgagcgcagc
aatgcggtgctcatctgccacgccctgaacgcctcgcaccatgtcgccggggtggcgtcc
gataatcccaaggatatcggctggtgggacaacatggtgggcccgggcaagcccgtggac
accaatattttctttgtcatcggcatcaataacctgggctcctgcttcggctcgaccggc
ccggccagcctcaacccggccacgggccagccctggggggcggcctttccggtattgacc
gtcgaagactgggtgcgcgcgcaggcgcgcgtggccgatcatttcggcatccagcgcttt
gccgccgtcatgggcggctcgctgggcggcatgcaggccctgagctggtccctgaccctg
cccgagcgggtggcgcattgcgtggtcatcgccagcacgcctcgcctgtcggcgcagaat
atcggcttcaacgaggtggcgcgccgcgccatcatcaccgatccggatttccacggcggc
aactactacgcccacaacaccgtgccgcgccggggcctggcggtcgcgcgcatgatcggg
cacatcacctatctgtccgatgacgacatggccgagaaattcggccgcacgcagcgcgag
cccgccgaaaacggcgcctaccgctatggctatgacgtcgaattcgaggtggagtcctat
ttgcgctaccagggcgagaagttctcgcgctatttcgacgccaacacctatttgctgatc
acccgtgcgctcgattatttcgatccggcgcgcgataccgggggagacctggcgcgcgcc
ctgtcgccggccacggccgacttcctgctggtgtctttcaccaccgattggcgtttcccg
cccgagcgttcgcgcgagctggtccgaggcctgctgaagaacggcagcccggtgacctac
gccgaaatcgatgcgccgcacggccatgacgcctttttgctcgaagacgcccgctaccac
gccgtggtccggggctattacgaacgcatcgcacgcagcctggggctgaggtcccagcaa
cccgccgaggaatgcctggcatga

DBGET integrated database retrieval system