KEGG   Bradyrhizobium icense: LMTR13_08210Help
Entry
LMTR13_08210      CDS       T04485                                 

Definition
(GenBank) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bic  Bradyrhizobium icense
Pathway
bic00970  Aminoacyl-tRNA biosynthesis
bic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bic00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LMTR13_08210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bic03029]
    LMTR13_08210
Enzymes [BR:bic01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LMTR13_08210
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LMTR13_08210
Mitochondrial biogenesis [BR:bic03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LMTR13_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANW05393
UniProt: A0A1B1URM1
Position
1725127..1726434
Genome map
AA seq 435 aa AA seqDB search
MSSRELVETCLSRIADPVGEGTRTFIRVWEKQARRAAQAQDDLLRAGYASSLLAGIPVSI
KDLFDVEGEVTLAGTRALDDCPPAAADAPIVKRLKAAGAVLVGRTNMTQFAFSAVGINPC
FGTPGNPWDRDRIPGGSSSGAAVSVADGMAIAAIGSDTVGSIRVPAALCGVVGFKPTQGA
VSREGAVPLSTTLDTVGPLARTVHDCALVHAAIAGEIQTMPKGASVSGLRLAVPTDVVLE
GLDADVSQTFQRACTMMSSAGAALRELPTGVFSDIRSENLNATIQSVEALAWHRDLLARR
RPDYDPNVRKRVERGAQFSAVDYVRALGRRTELMAKFDAVTAPFDALILPTVSIIAPSMD
ECRRDEDSIRAQLIRNPSLFNLLDRPSISIPMHRPGEPPTGLTIVGERYEDCRLLAIASA
VEELFISRSPDLLWR
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcagccgggagctcgtcgaaacctgcttgtcgagaattgccgacccagtgggcgag
ggtacgcgtaccttcatacgcgtttgggagaaacaggcccgacgggccgcccaggcgcag
gatgatctgcttcgcgccggctatgcctcatccctcctggcgggcattccggtgtccatt
aaggatttgttcgacgttgagggcgaagtcactctggccgggactagggcattggacgac
tgccctccggctgcggcggacgctcccatcgtcaagcgcctgaaggctgccggcgcggta
cttgtcggccgaaccaatatgactcagttcgcgttttccgcggtgggcatcaacccctgt
tttggtacgcctggaaatccctgggacagagaccgtatccccggcggatcctcctccggt
gctgcagtttcagtcgcagacgggatggcgatcgccgcgatcggctcggacactgtgggc
tcaatacgggttccggccgcgctttgcggcgttgtaggcttcaaacctacgcaaggtgcc
gtttcgcgcgagggggccgttccgctgtcgaccacgctcgacacggtcggcccgttggca
aggacggtccacgattgcgcgctcgttcacgctgcgatagccggcgaaattcaaacgatg
ccgaaaggtgcgagtgtgagcggcctgcgacttgccgttccgacggacgttgtccttgaa
gggctggatgccgacgtctcacaaacatttcagcgggcgtgcacgatgatgtcaagcgcc
ggtgctgcgctgcgcgagttgccaaccggcgttttttccgacattcggtcggagaatctg
aacgcgacgattcagtctgtcgaggcgctcgcctggcaccgcgacctgctggcccgccga
aggccagactacgatcccaacgtcagaaaacgcgtcgagcgcggtgcgcagttctctgct
gtggactacgtccgtgcgctcggccggcggaccgagttgatggcgaaatttgacgctgtc
acagccccattcgatgcgctgatccttccgacggtgtcgatcatcgcgccgtcaatggac
gaatgcaggcgtgacgaagatagcatccgcgcgcagctaatacggaatccctcgctcttt
aatctgctcgatcggccttcaatctcgattcctatgcatcgccctggcgaaccaccgaca
ggattgacaatcgtcggagaacgctacgaagattgccgactacttgccatcgcgagtgca
gtcgaggaattgtttatctcgaggagtccggatttgctttggagatag

DBGET integrated database retrieval system