KEGG   Bradyrhizobium icense: LMTR13_08795Help
Entry
LMTR13_08795      CDS       T04485                                 

Definition
(GenBank) hypothetical protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
bic  Bradyrhizobium icense
Pathway
bic00520  Amino sugar and nucleotide sugar metabolism
bic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    LMTR13_08795
Enzymes [BR:bic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     LMTR13_08795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: ANW00253
UniProt: A0A1B1UBY6
Position
complement(1863765..1864523)
Genome map
AA seq 252 aa AA seqDB search
MFVITNNKTGGNNNTQADLDGRIDRIYNLACPASPRHYQRDPLGTLRTCVLGAGHVIEFA
TEKGARVLQASTSEVYGDPDVHPQPETYLGNVNPVGPRACYDEGKRAAETVFFDCHRIHR
MSIKVARIFNTYGARMLENDGRIISNFIVQALKGTPITIYGDGSQTRSFCYIDDLLAGLQ
LLMESPPEITGPFNLGNPEEQTVRRIADLIVEQTGSKSTIEYHPLPRDDPKRRRPLISRA
RCAGLDIQDPSR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgttataacaaacaacaaaacgggaggaaacaacaatactcaagccgacctcgac
ggacgaatcgaccgcatctacaatctcgcgtgccccgcctccccgcgtcactatcagcgc
gatccgctcggaacgttacgcacgtgcgtccttggcgcaggccacgtgatcgaatttgcc
acggaaaagggcgcgcgagtacttcaggcatcgaccagcgaggtgtacggtgacccggac
gttcatccgcagcccgagacgtatctggggaatgtcaacccggttggtccgcgcgcctgt
tatgatgaaggcaagcgtgctgcggaaaccgtctttttcgactgccatcgcattcatcgc
atgtcgatcaaggtggcacgcatcttcaatacctacggtgcacgcatgttggagaacgac
ggccgcatcatttcgaatttcattgttcaagcgctcaagggcacccccatcaccatctat
ggcgacggctcccagactcgttcgttctgctacattgacgatctgttggccggtctccag
cttctgatggaaagcccacccgagatcaccggccctttcaatctcgggaatcctgaggag
cagacggtcaggcgaattgccgatctgatcgttgagcaaacgggatcgaagtccaccatc
gagtaccatccgctgcctcgggacgatcccaagcgtcgtcgccccctcatttcgcgcgcg
cgatgtgctgggctggatatccaagatccctctcgatga

DBGET integrated database retrieval system