KEGG   Bradyrhizobium icense: LMTR13_14030Help
Entry
LMTR13_14030      CDS       T04485                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bic  Bradyrhizobium icense
Pathway
bic00010  Glycolysis / Gluconeogenesis
bic00053  Ascorbate and aldarate metabolism
bic00071  Fatty acid degradation
bic00280  Valine, leucine and isoleucine degradation
bic00310  Lysine degradation
bic00330  Arginine and proline metabolism
bic00340  Histidine metabolism
bic00380  Tryptophan metabolism
bic00410  beta-Alanine metabolism
bic00561  Glycerolipid metabolism
bic00620  Pyruvate metabolism
bic00625  Chloroalkane and chloroalkene degradation
bic00903  Limonene and pinene degradation
bic01100  Metabolic pathways
bic01110  Biosynthesis of secondary metabolites
bic01120  Microbial metabolism in diverse environments
bic01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMTR13_14030
   00053 Ascorbate and aldarate metabolism
    LMTR13_14030
   00620 Pyruvate metabolism
    LMTR13_14030
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMTR13_14030
   00561 Glycerolipid metabolism
    LMTR13_14030
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMTR13_14030
   00310 Lysine degradation
    LMTR13_14030
   00330 Arginine and proline metabolism
    LMTR13_14030
   00340 Histidine metabolism
    LMTR13_14030
   00380 Tryptophan metabolism
    LMTR13_14030
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LMTR13_14030
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LMTR13_14030
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LMTR13_14030
Enzymes [BR:bic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LMTR13_14030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh KfrA_N
Motif
Other DBs
NCBI-ProteinID: ANW01128
UniProt: A0A1B1UEE2
Position
3005746..3007203
Genome map
AA seq 485 aa AA seqDB search
MTSAVRHLTEAGLLGKFYIDREWRKPTGSATAVVVNPATEQPIVEVALGNNEDVDRAVSA
ADRAFAGWSCKSAAERAALLDRIHGLILERLELFAQAVTGEMGAAISYARRAQVPLAAEH
IRVARDNLATYSFISPRGSTAIMREAIGICGLITPWNWPLYQITAKVGPALAAGCTVVLK
PSELSPLSALLFAEVMDDAGCPPGVFNLVNGTGPIVGASLASHPQVDMISITGSTRAGVL
VAQAAAPTVKRVAQELGGKSPNIILPDAELSRAVPLGVGAAFRNLGQSCSAPTRMLVSRS
QMAKVEVLAAAAASELVVGDPLAESTTHGPIANRPQFERIQAMIGVGLEEGAKLVIGGPG
RPDNLKIGLYARPTIFSNVRRDMRIAQEEIFGPVLSIIPYDTVDEAVEIANDTVYGLGAH
VQGADAKTLREVAGQIRSGQVHLNYPDWDPNAPFGGYKRSGNGREYGLEGMEEYLETKAV
PGFYR
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacctcggccgttcgacacctgacggaagccggcttgctcggcaaattctacatcgac
agagaatggcggaagccgaccggatcggcgacggcggtcgtcgtcaacccggcgaccgag
cagccaatcgtcgaagtcgcgctcggcaacaatgaggatgtagaccgcgctgtctccgcc
gctgaccgagcctttgccggctggtcttgcaagtcggctgcggagcgggcagcgctgctc
gaccgaatccatggtttgatcctcgagcggctggaattgttcgcgcaggcagtcacgggc
gagatgggggccgctatctcctatgcgcgccgcgcccaggtgcccctggccgccgaacat
atccgcgtcgcgcgtgacaatctcgcgacctattctttcatcagcccgcgcggcagcacc
gccatcatgcgcgaggccatcggcatctgcggcctcatcaccccctggaactggcctctc
taccagatcacagccaaggtcggtccggcgctcgcggctgggtgcacggtggtgttgaag
cccagcgaattgtcgcccctcagcgccttgctgttcgccgaggtgatggacgatgccggt
tgtccgcccggcgtattcaacctcgtcaacgggacaggtccaatcgtgggcgccagtctg
gcgtcgcatccgcaggtggacatgatctcgatcacgggctcgacccgtgccggggttctt
gttgcgcaagcggcggcgcccaccgtcaagcgcgtcgcccaggaacttggcggcaagtcg
ccgaatatcattctgccggatgccgagctgagccgggccgttccactcggcgtcggcgct
gccttccgcaatctcgggcaatcctgcagcgcaccgacgcgtatgcttgtttcccgctca
cagatggcgaaggtcgaagttctggctgcggcggccgcttctgaactggtggtaggcgac
ccgctcgcggaaagcacgacccatggtccgatcgccaaccggccgcagttcgagcgtatc
caggccatgatcggcgtcggtctggaggaaggcgccaagcttgtcattggcgggccgggg
cggcccgacaaccttaagatcggcctctatgcgcggccaacgatcttctcgaacgtccgt
cgcgacatgagaattgcgcaggaggagatcttcggcccggtgctgtcgatcattccctac
gatacggtcgacgaggcggtcgagatcgccaacgacacggtctacggcctcggcgcccat
gtgcagggcgcggatgcgaagacactgcgggaggtggccgggcagatccggtccggtcag
gtccatctcaactatcccgactgggacccgaacgcaccttttggcggatacaagcgttcc
ggcaacggccgggaatatggcctcgagggcatggaggaatatctcgagaccaaggccgtt
cccggattttaccgatga

DBGET integrated database retrieval system