KEGG   Bradyrhizobium icense: LMTR13_16770Help
Entry
LMTR13_16770      CDS       T04485                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bic  Bradyrhizobium icense
Pathway
bic03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bic00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LMTR13_16770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bic03011]
    LMTR13_16770
Ribosome [BR:bic03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LMTR13_16770
  Bacteria
    LMTR13_16770
  Archaea
    LMTR13_16770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANW01575
UniProt: A0A1B1UFR3
Position
3593945..3594331
Genome map
AA seq 128 aa AA seqDB search
MSKPKRERSLADNEAKAVARMLRVSPQKLNLVAQLIRGRKASAALADLQFSRKRIAVDVK
KCLESAIANAENNHDLEVDDLVVAEAHVGNGIVMKRFSPRGRGRSGRIYKPFSHLTIVVR
QVEAEASA
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaccaaagcgcgaacgtagcctcgcggataacgaggccaaggcagtcgcccgg
atgctgcgcgtcagcccgcagaagctcaatcttgtcgcgcaactgatccgcggccggaag
gcgtcggctgcgctcgccgacctgcagttctcgcgcaagcggatcgcggtcgacgtcaag
aagtgcctggaatcggcgatcgcgaacgccgagaacaaccatgacctcgaggtcgacgat
cttgtcgtcgccgaggcccatgtcggcaacggcatcgtcatgaagcgtttttcgccccgc
ggccgtggccgctcgggtcgtatctacaaaccgttctcgcacctgaccatcgtggttcgt
caggtcgaggccgaggcaagcgcttaa

DBGET integrated database retrieval system