KEGG   Bradyrhizobium icense: LMTR13_17830Help
Entry
LMTR13_17830      CDS       T04485                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bic  Bradyrhizobium icense
Pathway
bic00010  Glycolysis / Gluconeogenesis
bic00020  Citrate cycle (TCA cycle)
bic00620  Pyruvate metabolism
bic01100  Metabolic pathways
bic01110  Biosynthesis of secondary metabolites
bic01120  Microbial metabolism in diverse environments
bic01130  Biosynthesis of antibiotics
bic01200  Carbon metabolism
Module
bic_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMTR13_17830
   00020 Citrate cycle (TCA cycle)
    LMTR13_17830
   00620 Pyruvate metabolism
    LMTR13_17830
Enzymes [BR:bic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LMTR13_17830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: ANW01747
UniProt: A0A1B1UG67
Position
3789176..3790276
Genome map
AA seq 366 aa AA seqDB search
MHQFVLPDLGEGLEEAEIVNWYVNEGDHVVTDQPLVSVETDKAVVEVPSPSSGRILHLFG
AKGDVVKVGAPLVEFAEGPDQDTGTIVGELGASETPPAAAAPSGPAAGQKAQVFPAVRAL
ARKLDVDLDLVEATGPGGTITRADVERAAKGLSQSGPAELLRGLRRAMAQRMAAAHAEIV
PAGVTDEADIDDWRTGEDVTIRLVRAIAVACKAEPALNAWYNSGAGERRLIERIDLGIAV
DTGGGLIVPVLRNVAERDVSDLRAGLDRMRADAVARSIPPGELRGATITLSNFGMIGGRF
ASLIVVPPQVAIIGAGRITQGVVAYRGQPAVRRVLPLSLTFDHRVVTGGEAARFLVALKA
DLEQFS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaccagttcgtattgccggatctgggagagggcctcgaagaggcggagatcgtgaac
tggtatgtcaacgaaggcgatcacgtcgtcaccgatcagccgctggtttctgtcgagacg
gacaaggccgtcgtcgaggtgccgtcgccgtcgagcggacgcatcctgcatctgtttggt
gccaagggagatgtagtgaaggtaggcgccccgcttgtcgagtttgccgaaggccccgac
caggacaccggcacaattgtcggggaacttggcgccagcgagacgccgccggcagcagcg
gcaccttccgggccagcggctggacagaaagctcaggtttttccggcggtgcgtgcactg
gcccgcaagctcgatgtcgacctcgatctggtcgaagctaccggacccggcggcaccatt
acgcgcgcggatgtggaacgggctgccaagggcttgtcccaaagcggacctgccgaactc
ctgcgcggtttgcggcgcgcgatggctcaacgcatggcggcggctcatgccgagatcgtc
cccgccggcgtcaccgacgaggccgatatcgacgattggcgaaccggcgaggacgtgacg
atccggctggtgcgcgcgatcgctgtcgcctgcaaggccgagcctgcgctcaatgcctgg
tacaattccggggctggcgaacggcgcctgatcgagcgtatcgatctcggcatcgccgtc
gataccggcggcggccttatcgttcccgtgttgcgcaatgtcgcagagcgggacgtatcg
gacttgcgagccgggcttgaccggatgcgggcagacgccgtcgcgcgctcgatacctccg
ggagagctgcgcggggcgacgattacactgtcgaatttcggaatgatcggaggccgcttc
gccagcctgatcgtggtaccgccacaagtggcgatcatcggcgccggccggattacccaa
ggggtggttgcgtaccgcggccagccggcggtgaggcgcgtgttgccactgtcactcacc
ttcgaccatcgcgtcgtgacaggcggcgaagctgctcgcttcctggtcgcgctcaaggcg
gaccttgagcagttttcgtga

DBGET integrated database retrieval system