KEGG   Bradyrhizobium icense: LMTR13_21395Help
Entry
LMTR13_21395      CDS       T04485                                 

Definition
(GenBank) cysteine desulfurase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
bic  Bradyrhizobium icense
Pathway
bic00450  Selenocompound metabolism
bic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LMTR13_21395
Enzymes [BR:bic01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     LMTR13_21395
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     LMTR13_21395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ANW02348
UniProt: A0A1B1UHX3
Position
complement(4530804..4532051)
Genome map
AA seq 415 aa AA seqDB search
MTQHPAVKNGAYDVARVREDFPALAMKVYGKPLVYLDNAASAQKPTAVLDRMTEAYTSEY
ANVHRGLHYLANAATEAYEGARAKVAKFINAGRSEEIIFTRNVTEAINLVASSWGEPNIK
QGDEIVLSIMEHHSNIVPWHFLRERHGAVIKWAPVDDDGNFLIEEFEKLLTPRTKLVAIT
QMSNALGTFVPVKEVVKLAHDRGIAVLVDGAQGAVHLPIDVQDLDCDFYAFTGHKVYGPT
GIGALYAKHQHLVAMRPYNGGGEMIREVAKDWVTYGDPPHKFEAGTPPIVEAIGLGAAID
YVSSIGKERIAAHEHDLLNYAQERLREINSLRLIGTARGKGPVISFEMKGAHAHDVATVI
DRQGIAVRAGTHCVMPLLERFNVTATCRASFGMYNTREEVDHLAQALIKARDLFA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcatccggcggtcaaaaatggagcctacgatgtcgcgcgcgtgcgggaggat
ttccccgcgctggcgatgaaggtctatggcaagccgctggtctatctcgacaacgccgcc
tccgcgcagaagccgactgctgtgctcgatcgcatgaccgaggcttacacaagcgaatac
gccaatgtgcatcgcggcctgcattacctcgccaatgccgctaccgaggcttacgagggc
gcccgcgccaaggtagcgaaattcatcaatgcagggcgtagtgaagaaatcatcttcacc
cgcaatgtcaccgaggccatcaatttggtggcatcttcctggggcgagcccaacatcaag
cagggcgacgagatcgtgctctcgatcatggagcaccactccaacattgtgccctggcac
tttttgcgcgagcgccatggcgccgtgatcaaatgggcgccggtcgacgacgacggcaat
ttcctgatcgaggaattcgagaagctgctgacgccgcgcacgaagctcgtcgccatcacc
cagatgtcgaacgcgcttggcaccttcgtcccggtcaaggaagtcgtgaagctcgcccat
gaccgcggcattgcggtgctggtcgacggcgcgcaaggcgctgtgcatttgccgatcgac
gtgcaggacctcgattgcgatttctatgccttcactggccacaaggtctatggcccgacc
gggattggcgcgctctacgccaagcatcagcacctggtcgcgatgcggccctataatggc
ggcggcgagatgatccgcgaggtggctaaggactgggtcacctatggcgacccgccgcac
aagttcgaagccggcacgccgccgatcgtcgaggcgatcgggctgggcgctgcgatcgac
tacgtcagctcgatcggcaaggagcgcatcgccgcccacgagcacgatcttttgaattac
gcccaggagcggttgcgtgaaatcaattcgctgcgcctgatcggcaccgcgcgcggcaag
ggaccggtgatctccttcgagatgaagggggcgcacgcccacgacgtcgcaaccgtgatc
gaccggcagggcatcgcggtgcgcgccggcacccattgcgtgatgccgcttttagagcgg
ttcaatgtcacagccacctgccgggcgtcgtttggaatgtataatacccgggaagaagtc
gaccatctggcacaggcgctgatcaaggcgcgggatttgttcgcatga

DBGET integrated database retrieval system