KEGG   Bradyrhizobium icense: LMTR13_27345Help
Entry
LMTR13_27345      CDS       T04485                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bic  Bradyrhizobium icense
Pathway
bic00780  Biotin metabolism
bic01100  Metabolic pathways
Module
bic_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LMTR13_27345
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bic01007]
    LMTR13_27345
Enzymes [BR:bic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     LMTR13_27345
Amino acid related enzymes [BR:bic01007]
 Aminotransferase (transaminase)
  Class II
   LMTR13_27345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Beta_elim_lyase OKR_DC_1 DegT_DnrJ_EryC1 SHMT
Motif
Other DBs
NCBI-ProteinID: ANW03303
UniProt: A0A1B1UKQ7
Position
complement(5853305..5854459)
Genome map
AA seq 384 aa AA seqDB search
MNSTHAAKMTNYVTALHALKEDGRLRCLKPRAGVDFSSNDYLALASAPRMKMAVVSALEA
GTPVGAGGSRLLRGNCEEHESLEAKAAQFFGAETALFFSGGYFANFAVLTTLPQRGDFLV
LDSLVHASIHEGARAGRAEFRISAHNDPQSVEDTIRDWRAKGGTGRVWIVAESLYSMDGD
FAPLKHLVALADRYDAFLIVDEAHATGVYGEQGRGLTAPYEGRENLVVVHTCGKALGAAG
ALVTGTRVLRDFLVNRCRPFIFATAPPPLTAVAVREALSILREEPERQQRLAKLVAFTHR
EIVVRGRSSPSNSQVVPYVVGDNSRAMRLASAMQARGFDIRGIRPPTVPAGTARLRISLT
LNVREDDVSDMLDALVEETWSDSR
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgacccatgcggccaaaatgaccaattatgttacggccctgcatgccttaaaa
gaagacggccggctgcgctgcctcaagccgcgcgctggcgtcgacttttcttcgaacgat
taccttgcgctggcgagcgcgcctcgtatgaaaatggccgtcgtgtccgcgctcgaagcc
ggcacaccagttggagccggcgggtcgcggctcctgcgcggcaattgcgaggaacacgaa
agtctcgaagcaaaagcagctcagttctttggggcagagacggcgcttttctttagtggc
ggttatttcgcaaattttgctgtcctgacaacgctgcctcagcgcggcgattttcttgtt
ctcgattctctcgtgcacgcgagtattcatgaaggcgcgcgagctggccgggccgagttt
cggatcagcgcccacaacgatccccagtcagtcgaagacacaattcgtgactggcgggcc
aagggcggaacgggtcgcgtctggatcgtggccgagagcctctacagcatggatggtgat
ttcgcaccgcttaaacatctggtcgcgcttgcggatcgttacgacgcgttcctcatcgtg
gatgaggctcatgccacaggcgtttacggcgagcagggacggggcctcaccgcgccctac
gaggggcgcgaaaatctcgtggtcgttcatacctgcggcaaggcgctgggcgctgccggt
gcgctcgtcaccggcacacgcgtgctgcgcgacttcttggtcaatcgctgtcgcccgttt
atcttcgccaccgcgcccccaccgttgacggccgtcgccgtgcgggaggcactctcaatt
ctgcgggaggaacctgagcgtcagcagcgtctggccaagctggtcgcattcacacatcgg
gagatcgtcgtgcgcggtcgctcgagtccttcgaattcacaggtcgtgccctatgtcgtt
ggcgacaactcgcgcgcgatgcggctcgcatcggcgatgcaggctcgcggcttcgacatt
cgtggaatccggccgccaaccgtgccggcgggaacggcacgattgcgaatttcactcacg
cttaacgtcagggaagatgatgtatccgacatgcttgatgcgttggtcgaagagacgtgg
agcgattcgcgatga

DBGET integrated database retrieval system