KEGG   Bradyrhizobium icense: LMTR13_28620Help
Entry
LMTR13_28620      CDS       T04485                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bic  Bradyrhizobium icense
Pathway
bic00071  Fatty acid degradation
bic00072  Synthesis and degradation of ketone bodies
bic00280  Valine, leucine and isoleucine degradation
bic00310  Lysine degradation
bic00362  Benzoate degradation
bic00380  Tryptophan metabolism
bic00620  Pyruvate metabolism
bic00630  Glyoxylate and dicarboxylate metabolism
bic00640  Propanoate metabolism
bic00650  Butanoate metabolism
bic00900  Terpenoid backbone biosynthesis
bic01100  Metabolic pathways
bic01110  Biosynthesis of secondary metabolites
bic01120  Microbial metabolism in diverse environments
bic01130  Biosynthesis of antibiotics
bic01200  Carbon metabolism
bic01212  Fatty acid metabolism
bic02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LMTR13_28620
   00630 Glyoxylate and dicarboxylate metabolism
    LMTR13_28620
   00640 Propanoate metabolism
    LMTR13_28620
   00650 Butanoate metabolism
    LMTR13_28620
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LMTR13_28620
   00072 Synthesis and degradation of ketone bodies
    LMTR13_28620
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LMTR13_28620
   00310 Lysine degradation
    LMTR13_28620
   00380 Tryptophan metabolism
    LMTR13_28620
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LMTR13_28620
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LMTR13_28620
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LMTR13_28620
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bic04147]
    LMTR13_28620
Enzymes [BR:bic01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LMTR13_28620
Exosome [BR:bic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LMTR13_28620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N OB_aCoA_assoc ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANW03518
UniProt: A0A1B1ULD4
Position
6132541..6134055
Genome map
AA seq 504 aa AA seqDB search
MSNSPLLEDRIPVIVGVGEIVDRPKDIADGLEPLALLEQAVRRAEADSGAKLLGELGSLD
VVNFLSWRYRDPEKQLATRLGANPAHCYYGPVGGESPIRYIHEAAQRIARGECSVAVVCG
AEAQSTATKAERGGISLPWTPFAHDVEEPKRGAAFQKPMAVKLGVFRPITVYPLYESATS
AHWGQTPREALAESGELWSTYSKVASENPNSWLKKRFAPEEIITPTPENRLIAWPYTKLM
VANPTVNMGGAVLLTSLAKARAAGVAADRLIYPVGGASAEEPRDYLVRDQFYESHPQNAV
LKAVMDIVEGDGRKFGAIELYSCFPCVPKMARRTLGLGPDVQPTVTGGLTFFGAPLNTYM
THAACAMVRKLREGGKLGLLYGQGGFVTKHHGLVLSREEPKEALKQDTSVQAEADRNRRP
VPDFVTEASGKGKVESFTVIYTGKGEVEHGVVMLRTEQDARALARVPAGDAATLAHLLDM
DRTPVGSVGSIVTADDGVLEWRVG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaactctcccctcctcgaagaccgcattcccgtcatcgtcggcgtcggtgaaatc
gtcgaccggccaaaggacatcgccgatggcctcgagccgctggcgttgctcgagcaggcg
gtgcggcgcgcggaggccgatagcggcgcaaagctgctcggcgaactcggctcgctcgat
gtcgtcaatttcctgagctggcgctaccgcgatcccgagaagcagcttgcaacgcggctc
ggcgccaatccagcgcattgctattacggcccggtcggcggcgagagcccgatccgctac
attcacgaagccgcacaacgcatcgcgcgcggcgaatgcagcgtggcggtggtctgcggc
gcggaagcgcaatcgaccgcgaccaaggccgagcgcggcggcatctcgctgccatggaca
ccgttcgcccatgacgtcgaggaaccgaagcgcggcgcggcgtttcagaagccgatggcg
gtaaagctcggtgtgttccgccccatcacggtctatccgctctatgaatccgccacgtca
gcacattggggccagacgccgcgcgaggcgctcgccgaatccggcgagctgtggtcgacc
tattcgaaagtggcgtccgagaatcccaattcgtggctgaaaaagcgttttgcaccagag
gagatcatcacgccgacgccggagaaccggctgatcgcctggccgtatacaaaactgatg
gtggccaatccgaccgtgaacatgggcggggcggtgctgctgacgtcgctggcgaaagcg
cgcgcggccggagtcgcggcggatcgcctgatctatccggtcggcggcgcttccgccgaa
gagccgcgcgactatctggtgcgcgaccagttttatgaaagccatccgcagaacgccgtg
ctgaaggcggtgatggacatcgtcgaaggcgacggcaggaaattcggcgccatcgagctc
tatagctgcttcccctgcgtgccgaagatggcgcggcggacgctgggtctcggccccgac
gtgcagccgacggtgaccggcgggctcaccttcttcggcgcgccgctcaacacctacatg
acgcacgcggcctgcgcgatggtgcggaagctgcgtgaaggcggcaagctcggcctgctc
tacggccagggcggcttcgtcaccaagcatcatggcctggtgctgtcgcgcgaggagccg
aaagaggcgctcaagcaggacaccagtgtccaggccgaggccgaccgcaaccgccgcccg
gtaccggacttcgtcaccgaggcttcaggcaagggcaaggtcgagagctttaccgtgatc
tacacgggcaagggcgaggtcgagcacggcgtggtgatgctgcgcaccgagcaggatgcg
cgggcgctggcgcgtgtgcccgctggtgacgcagcgacgctggcgcatctcctggacatg
gaccgcaccccggtaggatcggtcggctcgatcgtcacggctgacgacggcgtgctggag
tggcgggtgggatag

DBGET integrated database retrieval system