KEGG   Bradyrhizobium icense: LMTR13_30510Help
Entry
LMTR13_30510      CDS       T04485                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
bic  Bradyrhizobium icense
Pathway
bic00740  Riboflavin metabolism
bic00790  Folate biosynthesis
bic01100  Metabolic pathways
bic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    LMTR13_30510
   00790 Folate biosynthesis
    LMTR13_30510
Enzymes [BR:bic01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     LMTR13_30510
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     LMTR13_30510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ANW03834
UniProt: A0A1B1UM23
Position
complement(6562659..6563738)
Genome map
AA seq 359 aa AA seqDB search
MADTIQEVLQAFAMGELVVVTDDDDREGEGDLIVAASLCTAEKMAFIIRHTSGIVCAPIT
TDDARRLRLDPMVAHNESNHTTAFTVSIDYKPDGGTGISAEERASCCRALANPNAGANDF
ARPGHIFPLIARDGGVLLRSGHTEAAVDLCKLSGLPPVGVISELMNDDGTVMKGEQVAKF
AAAHKLKHVTIADMIAYRQAREKLIERVATFTTDSPIGPLQGYAYRSPFDEIAHAAFVYN
GVGDGKNVLTRLHKPNIVKDLFTGQARMQIVLDHFKKAGRGVLVYLRDGAAGVPVEPVGE
QKTAEADRHRQWREVGVGAQILRDLGITSIVNLTSSVHDYKGLSGFGIEIVSNEKLEGQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccgatacgatccaggaagttctgcaagcctttgccatgggcgagctcgtcgtcgtc
accgacgacgacgaccgtgagggcgagggtgatctgatcgttgcagcttccctctgcacc
gcggagaaaatggcattcatcatccgccatacctccggcatcgtttgcgcaccgatcact
acggacgacgcgcgccggctgcggctcgatccgatggtggcgcataacgagtccaatcac
accaccgcctttaccgtctcgatcgactacaagcccgatggcggcaccggcatttcggcg
gaggagcgcgcctcctgctgccgcgcgctcgccaatcccaacgccggcgccaacgacttt
gcccggccaggccacatctttccgctgatcgcacgcgacggcggcgtgctcttgcgctcc
ggccataccgaagcggcggtcgatctctgcaagctttccggcctgcctccggtcggcgtc
atctccgagttgatgaacgacgacggcaccgtgatgaagggcgagcaggtcgcgaaattc
gccgccgcccacaagctcaagcacgtcacgatagctgacatgatcgcctaccgtcaggcg
cgcgaaaagctgatcgagcgggtcgcgacgtttacgaccgacagcccgatcggaccgctc
cagggctatgcctatcgctcgcccttcgacgagatcgcgcatgctgccttcgtctataac
ggcgtcggcgacggcaagaacgtgctgacgcgcttgcacaagcccaacatcgtcaaagat
ctcttcacgggccaggcgcggatgcaaatcgtactggatcatttcaagaaggccggtcgc
ggcgtgctggtgtacctgcgcgacggcgcggccggggttcccgtcgaaccggttggcgaa
cagaaaacggcggaggccgataggcaccggcaatggcgtgaagtcggcgtcggcgcccag
atcctgcgcgatctcggcatcacttcgatcgtcaatctcacgtcctccgtgcacgactac
aagggattatccgggttcggcatcgaaattgtttccaacgagaagttggagggacagtag

DBGET integrated database retrieval system