KEGG   Beijerinckia indica: Bind_0008Help
Entry
Bind_0008         CDS       T00688                                 

Definition
(GenBank) uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bid  Beijerinckia indica
Pathway
bid00860  Porphyrin and chlorophyll metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bind_0008
Enzymes [BR:bid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Bind_0008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 ANF_receptor
Motif
Other DBs
NCBI-ProteinID: ACB93667
UniProt: B2IAW7
Position
6552..7292
Genome map
AA seq 246 aa AA seqDB search
MLVLITRPFEEALRSAAKLEGAGYSALLSPVLTMRATGASWPEGVVDGVIATSAQAFDLL
VLRPEWPLPEALRLMPLWLVGDRTGDAAHRKGFDGPVRLAPHAKLLAQEITAALSPPARL
IYLAGQDRKPDLEKKLSKAGLTVEAQEIYAAEAVDQLSDIALESLRRNDVGAAMHYSRRS
AEIFLGLMRKAELDPATFVHICMSEDVAVPLKDAGCATQVAATSNEEGMLDALKAIAAAR
ESSRES
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgctggttctgatcacgaggcctttcgaggaagccctgcgcagcgccgccaagctcgag
ggagccggctattccgcgctcttgtcgccggtcctcaccatgcgcgccacgggagcctcc
tggcccgagggcgtcgttgatggcgtgatcgcgaccagcgcccaagctttcgatcttttg
gttctgcggcctgaatggcccttgccggaagcgcttcgtctgatgccgctatggctcgtc
ggagatcgaacgggcgatgcggcgcaccgcaagggatttgacggtccggtacgattagct
ccccatgcgaaactcctagcgcaggaaattaccgccgccctttcgccgccagcgcgcctc
atctatctcgcaggccaggatcgcaagcccgatctcgaaaagaaattgagcaaggcgggt
ctgaccgttgaagcccaggaaatctacgccgcggaggcggttgaccaattgagcgatatc
gcccttgagtccttgaggcgcaatgatgttggcgcggccatgcattattcacggcgcagc
gccgagatttttcttggcctgatgcggaaggccgaactcgatccggcgacattcgtgcat
atctgcatgtcggaggatgtggctgtgccgctgaaagatgccggttgcgcgacgcaggta
gccgcaacctcgaatgaagaaggcatgctcgacgcgcttaaggccatagccgccgcgcgg
gagtcttctcgggagtcttga

DBGET integrated database retrieval system