KEGG   Beijerinckia indica: Bind_0427Help
Entry
Bind_0427         CDS       T00688                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bid  Beijerinckia indica
Pathway
bid00071  Fatty acid degradation
bid00072  Synthesis and degradation of ketone bodies
bid00280  Valine, leucine and isoleucine degradation
bid00310  Lysine degradation
bid00362  Benzoate degradation
bid00380  Tryptophan metabolism
bid00620  Pyruvate metabolism
bid00630  Glyoxylate and dicarboxylate metabolism
bid00640  Propanoate metabolism
bid00650  Butanoate metabolism
bid00900  Terpenoid backbone biosynthesis
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
bid01212  Fatty acid metabolism
bid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bind_0427
   00630 Glyoxylate and dicarboxylate metabolism
    Bind_0427
   00640 Propanoate metabolism
    Bind_0427
   00650 Butanoate metabolism
    Bind_0427
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bind_0427
   00072 Synthesis and degradation of ketone bodies
    Bind_0427
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bind_0427
   00310 Lysine degradation
    Bind_0427
   00380 Tryptophan metabolism
    Bind_0427
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bind_0427
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bind_0427
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bind_0427
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bid04147]
    Bind_0427
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bind_0427
Exosome [BR:bid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bind_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt B12-binding
Motif
Other DBs
NCBI-ProteinID: ACB94080
UniProt: B2IE56
Position
complement(481259..482434)
Genome map
AA seq 391 aa AA seqDB search
MSSDVVIVGAARTAVGSFSGAFGNTPAHELGATVIKATLERAKVEAADVDEVILGQVLTA
ASGQNPARQTAIKAGIPDSKTAWTVNQVCGSGLRAVALGLQQINNGDAKIIVAGGQENMS
LSPHAAFLRGGTKMGDVKFTDTMMRDGLTDAFANYPMGNTAEHIATKWQISREEQDQFAV
ASQNKAEAAQKEGRFNEEIIPFTVPGKKGDIIVDKDEYIRIGATIEAMAKLKPAFVKDGT
VTAGNSSGINDGAAAVVLMSADEAKARGLTPLARIASWATAGVDPSIMGSGPIPASRKAL
EKAGWKVKDLDLIEANEAFAAQAIAVNKDMGWDTSLVNVNGGAIAIGHPIGASGARVLVT
LLHEMKRRDAKKGIATLCIGGGMGIAMTIER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgatgtcgtgattgtgggtgcagcgcgcaccgccgtcgggtccttcagcggc
gccttcggaaatacgcctgctcatgaattgggagcgacggtgatcaaggcgaccctcgag
cgcgccaaagtcgaggcggccgatgtcgacgaagtgatcctcgggcaggtcctgaccgct
gcttctggtcaaaacccggcccgccagacggccatcaaggccggtattccggacagcaag
acggcctggacggtgaatcaggtctgtggctcgggtctgcgcgccgtggcgctcggcctg
cagcagatcaataatggcgacgccaagatcattgtcgccggtggtcaggaaaacatgtcg
ctttcgcctcacgcggcctttctgcgtggcggcaccaagatgggtgatgtcaagttcacc
gatacgatgatgcgcgacggcctcaccgacgcctttgccaattatccgatgggcaatacg
gcggaacatatcgccaccaaatggcagatcagccgcgaggagcaggaccagttcgccgtg
gcctcccagaacaaggcggaagccgcgcagaaggaaggccgcttcaacgaggagatcatc
cccttcaccgtccccggcaagaagggcgatatcatcgtcgacaaggatgaatatatccgc
atcggtgcgacgatcgaggccatggccaagctgaaacccgcctttgtcaaggatggcacg
gtgacggccggcaattcttccggcatcaatgacggcgccgccgccgtggtgttgatgagc
gccgacgaggccaaggcacgcggcttgacgcctctcgcccgaatcgcttcctgggcgacc
gctggcgtcgatccgtccatcatggggtcgggcccgattccggcctcccgcaaggcgctc
gaaaaggccggctggaaggtcaaggatctcgatctcatcgaggccaatgaggctttcgcc
gctcaggccatcgccgtcaacaaggacatgggttgggacacctccctcgttaatgtcaac
ggcggcgcgattgccatcggccatccgatcggcgcttcgggggcccgcgttctcgtgacc
ttgctgcacgagatgaaacggcgcgatgcgaaaaagggtatcgcgaccctctgcatcggc
ggtggcatgggcatcgcgatgacgatcgaacgctaa

DBGET integrated database retrieval system