KEGG   Beijerinckia indica: Bind_0461Help
Entry
Bind_0461         CDS       T00688                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bid  Beijerinckia indica
Pathway
bid00361  Chlorocyclohexane and chlorobenzene degradation
bid00625  Chloroalkane and chloroalkene degradation
bid01100  Metabolic pathways
bid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bind_0461
   00361 Chlorocyclohexane and chlorobenzene degradation
    Bind_0461
Enzymes [BR:bid01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Bind_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ACB94114
UniProt: B2IE90
Position
complement(522152..522874)
Genome map
AA seq 240 aa AA seqDB search
MGATSLLARTKIVQAAPSPIRAIAFDGFPIFDPRSVPMLARDMLGERGELLAAQWSNKIF
SYSWLLTAAGHYQDFRTLADTTLSYTAHAMDLTLDDNTRQRLINQYESLDIWPDVKPALE
RLRTANIRLAFLSNLGATTLMANMNRNGIASYFEAPISTDRVKRFKPAPEAYKMAVDAFG
LPREQIGFAAFGGWDAIGATWFGYRTAWVNRLGLPAEPFDIRPEITSRGMEGVLTLAGLT
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaacgagtttgctcgcccgcacaaagatagtacaagcggccccctcgcccatc
cgtgctatcgcatttgatggatttcccattttcgacccgcgcagcgtcccaatgctcgcg
cgcgatatgctcggcgagcgaggcgaattgcttgcagcgcaatggtcgaacaagattttt
agctatagctggcttctaacggcagcgggacactaccaagatttcagaacattggcggat
accactctatcctacacagctcatgcaatggatctcacactggatgacaatacgcgccaa
agactcatcaaccagtatgaatcattagacatatggccggatgtaaagccagcgcttgaa
cgattgcgcacggccaatatcagactcgcattcctgtccaatctcggcgccacgacattg
atggccaatatgaaccgcaatggcatcgcaagctattttgaggccccaatcagcaccgat
cgcgtgaaacgtttcaagccggctcctgaagcctataaaatggcggtcgatgcctttggc
ctgccacgtgagcagatcggtttcgctgcttttggcggttgggacgcgattggggcaacc
tggttcggttaccgaacggcgtgggtgaatagattaggcctgcccgctgaaccgttcgac
atacgtcctgagattacgagccgtgggatggaaggcgttcttacccttgcggggcttact
tga

DBGET integrated database retrieval system