KEGG   Beijerinckia indica: Bind_0814Help
Entry
Bind_0814         CDS       T00688                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
bid  Beijerinckia indica
Pathway
bid00780  Biotin metabolism
bid01100  Metabolic pathways
Module
bid_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Bind_0814
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bid01007]
    Bind_0814
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Bind_0814
Amino acid related enzymes [BR:bid01007]
 Aminotransferase (transaminase)
  Class II
   Bind_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ACB94464
UniProt: B2IH50
Position
complement(907706..908866)
Genome map
AA seq 386 aa AA seqDB search
MNSLDAFAAAKLADLEERGLRRTLRENWREDGLWISVDGQKLLSFSCNDYLNLTHHPALK
AAAIRAIETYGVGAGASRLVTGNHPLLEKLEARLAALKGSEAACIFGAGYLANTGIIPTL
VGKDDLILIDELAHACLFAGTQLSPATVRIFRHNDIAEVESLLATNRAHYRHALLLTDGV
FSMDGDLAPLPALAEICTHHDCWLMADDAHGLGVIGQGRGSRHAFDPAPVIPLQMGTLSK
AIGGYGGYLCASKPVIDLMKTRARTVVYSTGLPPALAASALAALDLIESDSDLVKKPLAN
ARLFTTRLGLSPAQSPIVPIILGTVEAVMSAAQTLFTQGFLVTPIRPPTVPEGTARLRFA
FTAGHAAEDILHLADVVAPLMPAKAR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaactctctcgatgcttttgccgccgccaaactggccgatctcgaagagcgcggcctg
cgccggaccctccgcgagaattggcgcgaggacggcctatggatcagcgtggatggacaa
aagcttctctccttctcctgcaacgattatcttaatctcacccatcatcccgccctcaag
gcagcggccattcgggccatcgaaacctatggtgttggcgccggcgcctcgcggctcgtg
accggcaatcatcctctcctcgaaaaactcgaggcgcggctcgccgcgctcaagggatcc
gaggcggcttgcatcttcggcgccggttatctcgccaatacgggcatcatcccaaccctt
gtgggcaaggatgatcttatcctgatcgatgaactcgcccatgcctgtctgttcgccggc
acacagctttcacccgcaacggtccgtatcttccgccataatgatattgcggaagtcgaa
tccctcctcgccactaaccgggctcattatcgccacgcacttctcctgactgatggcgtt
ttttccatggatggtgatctcgctcccctgcccgctttggcggagatttgcacgcatcac
gattgttggctgatggctgatgatgcccatggtctcggcgtcatcggccaaggacgcggc
tcccggcatgcttttgatcccgcacccgtgatccctttgcaaatggggactttgtccaag
gcgatcggtggctatggcggctatctctgcgcctcgaaaccggtgatcgacctcatgaag
acgcgggcgcgcactgtcgtctattcgactggcctgccaccagcgctcgcagccagcgca
ttggcggcgctcgatctcattgaaagcgattctgatctcgtcaaaaaaccgctggccaat
gcgcggctcttcaccacccgcctcggtttatcccccgcgcaaagccccatcgtgcccatt
atcctcggcacggtcgaggccgtgatgagtgccgcgcagactctcttcacacaggggttt
ctggtgacaccaatccgaccgccgaccgtgccggaagggacggcccggcttcgctttgcc
tttaccgctggacatgcggctgaagacatcctgcatctcgcggatgtggtcgcacccttg
atgccggcaaaagcgagataa

DBGET integrated database retrieval system