KEGG   Beijerinckia indica: Bind_0831Help
Entry
Bind_0831         CDS       T00688                                 

Definition
(GenBank) lipolytic protein G-D-S-L family
  KO
K10804  acyl-CoA thioesterase I [EC:3.1.2.- 3.1.2.2 3.1.1.2 3.1.1.5]
Organism
bid  Beijerinckia indica
Pathway
bid01040  Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bind_0831
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bid01004]
    Bind_0831
Enzymes [BR:bid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.2  arylesterase
     Bind_0831
    3.1.1.5  lysophospholipase
     Bind_0831
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     Bind_0831
    3.1.2.-  
     Bind_0831
Lipid biosynthesis proteins [BR:bid01004]
 Fatty acid synthase
  Component type
   Bind_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lipase_GDSL_2 Lipase_GDSL Peripla_BP_1 OSK baeRF_family2 TAT_signal
Motif
Other DBs
NCBI-ProteinID: ACB94481
UniProt: B2IH68
Position
929582..930328
Genome map
AA seq 248 aa AA seqDB search
MKRTNEIATDAVRTVVHEATNKAADADATFAAYKQRRHFLQSTAGLFAAIALGMSGKGWA
ATNPLKIVALGDSLTAGYLLPAQAAFPVVLEKALRNQGYDVRLINAGVSGDTAAGGLARL
DWSLGEGVDGVIVELGANDMLRGIDPASTRATLAEILTRLRQRRIKALLAGMRAAPNLDA
LYREQFEAIYPALAQQFDVPFYPFFLDGVAGNPALELPDRVHPNQEGVERIVEKFLPLAE
RFVQSLGS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaccaacgagattgcgaccgatgcggtgaggacggtagtccatgaggcgaca
aacaaggcggctgatgccgacgccacctttgccgcatataagcagcgacggcattttctc
caatccacggcgggccttttcgcagccatcgcccttggcatgagcggaaaaggctgggcc
gcgacaaacccgctcaaaatcgtcgccctgggtgatagtctgaccgccggctatctcttg
ccagcccaggcggcgtttccggtggtgcttgaaaaagccttgcggaaccaagggtatgac
gtgcggctgatcaatgccggtgtctccggcgatacggcggcgggcgggcttgcccgcctc
gattggagccttggcgagggcgtcgatggcgtgattgtcgagctgggcgccaatgatatg
ttgcgggggatcgatccagcgtcgacacgcgcgaccttggccgagatcctgaccaggctg
cggcagcgtcgaatcaaggccctgctcgcaggcatgcgggcggcacccaatctcgatgcc
ctttatcgggaacaattcgaggcgatttatcctgctctcgcacagcagttcgatgtacca
ttctatccgtttttcctggacggcgtggcgggtaatccagcgctggaactgcccgatcgc
gtgcatcccaatcaagagggcgtggaacggatcgtcgagaaatttttgcccctggctgag
cgtttcgtgcaaagcttgggaagttga

DBGET integrated database retrieval system