KEGG   Beijerinckia indica: Bind_1041Help
Entry
Bind_1041         CDS       T00688                                 

Definition
(GenBank) urease, alpha subunit
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
bid  Beijerinckia indica
Pathway
bid00220  Arginine biosynthesis
bid00230  Purine metabolism
bid01100  Metabolic pathways
bid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Bind_1041
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Bind_1041
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    Bind_1041
Enzymes [BR:bid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     Bind_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3 Molybdopterin_N
Motif
Other DBs
NCBI-ProteinID: ACB94684
UniProt: B2IIJ1
Position
complement(1193551..1195263)
Genome map
AA seq 570 aa AA seqDB search
MAVTLPRPAYAGMFGPTTGDKVRLADTELFIEIERDFTLYGEEVKFGGGKVIRDGMGQGQ
ASKAEGAADTIITNAVIIDHWGIVKADVGLRDGRIIGIGKAGNPDVQPGIDLIIGPGTEI
IAGEGRILTAGGFDSHIHFICPQQIEEALASGMTTMLGGGTGPATGTFATTCTPGPWHIA
RMIEASDGFAMNLGFAGKGNASRSEGLVEQIEAGACALKLHEDWGTTPAAIDCCLSVADD
HDIQVMIHTDTLNESGFVEDTIRAFKGRTIHAFHTEGAGGGHAPDIMKVAGLPNVLPSST
NPTRPFTVNTLDEHLDMLMVCHHLDPSIAEDLAFAESRIRKETIAAEDILHDLGALSMMS
SDSQAMGRIGEVITRTWQTADKMKRQRGPLPEDKSNNDNFRVRRYIAKYTINPAITHGVS
RHIGSIEPGKLADLVLWTPAFFGVKPDLVIKGGMIAYAMMGDPNASIPTPQPVHGRPMFG
SFGGARTGTSLTFTSKTALAHGLAQKLKISRKLVPVENTRGNLRKTSLILNGAMPHIEID
PETYVVKADGMVLTCEPARSLPMAQRYFLF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaccctaccccgccccgcttatgccggcatgtttggaccgaccacgggcgac
aaggttcgccttgccgatacggagcttttcatcgagatcgaacgcgatttcaccctttat
ggcgaggaagtgaaatttggcggcggcaaggtcattcgcgacgggatgggacaaggccag
gcctcaaaagccgagggcgcggcggatacaattatcaccaatgccgtgatcatcgaccat
tggggcattgtcaaagccgatgtcgggctgcgtgatgggcgcattatcggcattggcaag
gcgggcaatcccgatgtccagccgggcatcgatctcatcatcggccctggcaccgaaatc
attgccggtgagggacgcattctcaccgctggcgggttcgacagccatattcatttcatc
tgccctcaacaaattgaagaggccttggcctcgggcatgacgacaatgctcggcgggggc
accggcccagcgacaggcactttcgcgacgacctgcacgccaggaccctggcatattgcc
cggatgatcgaagcctctgacggtttcgccatgaacctcggttttgccggcaagggcaat
gcctccagatctgaaggtctcgtcgagcagatcgaggcgggcgcttgcgccctgaaactg
catgaggattggggcacgacaccagcggccatcgactgctgcctgtccgtcgctgatgat
cacgatatacaggtcatgatccacacggatacattgaacgaatccggtttcgtcgaggac
acgatccgcgccttcaaggggcgcaccattcatgccttccacaccgaaggcgccggaggc
ggccatgcgcccgacattatgaaagtcgcgggcctgcccaatgtcctgccttcctcgacc
aatccgacacggcccttcaccgtcaatacgctcgacgaacatctcgacatgctgatggtt
tgccatcatctcgatccctccattgcggaggatctcgccttcgccgaaagccgtatccgc
aaggaaaccattgcggctgaggatattctgcacgaccttggtgctttatcgatgatgtcc
tcggatagtcaggccatgggacgcatcggcgaggtgatcacacgcacctggcagacagcc
gataagatgaagcgtcagcgcggaccactccccgaagacaagagcaataacgacaatttc
cgtgtgcgccgttacattgccaaatacacaatcaatccggccatcactcatggcgtttcg
cgtcacatcggctcgatcgagcccggcaagctcgccgatcttgttttatggacgcctgct
tttttcggcgtgaagccggatctcgtcatcaagggcggtatgatcgcctatgcgatgatg
ggcgatcccaacgcctcgatcccgacaccgcaacccgtgcatgggcgcccaatgttcgga
agttttggcggggcacggaccggcacgtccttaacttttacgtcgaagacggccctggcg
catggcctggcccaaaagctcaaaatttcgcgtaaattagtacccgtcgaaaacacccgc
ggaaatttgcgcaagacgagcctgatcctcaacggcgcgatgcctcacatcgagatcgat
ccggaaacctatgtggtcaaggctgatggcatggtactgacctgcgagccagcgaggagc
ctgcccatggcgcagcgctattttctgttctga

DBGET integrated database retrieval system