KEGG   Beijerinckia indica: Bind_1300Help
Entry
Bind_1300         CDS       T00688                                 

Definition
(GenBank) alpha/beta hydrolase fold
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
bid  Beijerinckia indica
Pathway
bid00270  Cysteine and methionine metabolism
bid00920  Sulfur metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Bind_1300
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bind_1300
Enzymes [BR:bid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     Bind_1300
    2.3.1.46  homoserine O-succinyltransferase
     Bind_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ACB94941
UniProt: B2IJR9
Position
1507015..1508061
Genome map
AA seq 348 aa AA seqDB search
MAHSYYNQESHGPYQTLDLGPFVLDNGDTIRNLALAYATFGSLSPAKDNAILFPTWYSGT
SKILEQAYIGPGRALDPERYFIILVNQIGNGLSSAPHNQPSPFNAARFPRVSISDDVRAQ
YRLVTEHFGIERLQLVLGGSMGAQQTYEWAVRYPEQVLRAAPIAGTARASVHNRLVVEGL
IAAIASDPAFDNGWYAEPGLVHRGLRRHAQLFATKVFSSRLFEQEGWRALGFSSVDDFLS
GFVEQHFLQQDPNNLILLARKWQDSDVSRNTSGDLKKALSHITATTFVVAVDEDDLFPLA
DIVAEQTLVPQSHLKRLSSPWGHLAIFGLDQAYRDNIDSVLKELLATP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggcccattcctattataaccaagagagccacgggccctatcagaccctcgatcttggt
cccttcgtcctcgacaatggcgatacgatccgtaatctcgctctcgcttatgcgaccttt
ggctcgctctcgcccgccaaggacaatgcgatcctgttccccacctggtattcgggcacg
agcaagatcttggaacaggcctatatcggccccgggcgggcgctcgatcccgaacgctat
ttcatcattctcgtcaatcagatcggtaatggcctctcaagcgcgccgcacaaccagccc
tctccgttcaatgcggcgcggtttccgcgcgtgtcgattagtgatgacgtgcgggcgcaa
tatcgtctggtgaccgaacatttcggcattgaacgtctgcaactcgtcctgggtggatca
atgggcgcgcagcagacttatgaatgggctgtgcgttatccggagcaggtgttgcgcgcc
gcgccgattgcgggaacggcgcgcgcgagcgtgcataatcgtctcgttgtcgaagggttg
atcgcggcaatcgccagcgacccggcttttgacaatggttggtatgctgagcccggcctg
gttcatcgtggcttgcgccggcatgcgcaattgtttgcgacaaaggttttctcttcacgt
ctgttcgaacaggagggctggcgcgccctcggcttttcctccgtcgatgattttctctcg
ggcttcgtcgaacagcattttctgcaacaggatccaaacaatctgatcctgctcgcgcgc
aaatggcaggatagtgatgtgagccgcaacacgagcggcgatctcaaaaaggctttgtcg
catatcaccgctactacattcgttgtcgcggtcgatgaagacgatctgtttcccctggcc
gatatcgtggctgaacagacgctggtgccacagagccatttgaagcgcctctcctcgccc
tggggtcatctcgccatttttggtctcgatcaggcctatcgggacaatatcgactccgtg
ctgaaagagcttttggcaacgccgtga

DBGET integrated database retrieval system