KEGG   Beijerinckia indica: Bind_2813Help
Entry
Bind_2813         CDS       T00688                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bid  Beijerinckia indica
Pathway
bid00220  Arginine biosynthesis
bid00330  Arginine and proline metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01130  Biosynthesis of antibiotics
bid01230  Biosynthesis of amino acids
Module
bid_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Bind_2813
   00330 Arginine and proline metabolism
    Bind_2813
Enzymes [BR:bid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bind_2813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ACB96382
UniProt: B2IK07
Position
complement(3204801..3205712)
Genome map
AA seq 303 aa AA seqDB search
MTLTLSRTLPQTSTRMQTGEGAFRLAQAAEPFIVALRGWVCDRYTSGGMQGASLLAHATS
ARLNAPVLELGEPESAQNLMWRESLDKATPYLRDVGGVIDEIMGHRRFPMIFANRCGASL
ATIAAALRHRPDAKVIWCDAHGDFNTPASTPTGYLGGMVLTALCGLWDSGLGTGLSADRI
ILVGQRDIDPGEQALIDHHGVTLLTAHKGHIDHQALLDAIGGAPVWFHIDTDVIDPLYLP
AEYRVDAGLSPQAVQDMLATIVEAVELVGFEMTEFEAPPTRELREPIIEAIMTMLSPLWI
ANL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgactttgactctttctcggaccctcccgcagacttctactcggatgcaaacaggtgaa
ggcgcgttccgtcttgcccaggcggcggagcctttcattgtggccttgcgtggctgggtt
tgcgatcgctatacgagcggcggcatgcagggcgcttccttgctggctcatgccacatcc
gcgcggctcaatgcgcccgtgcttgaactcggcgagccggaatccgcacaaaatctcatg
tggcgggaaagcctcgacaaagccacgccctatcttcgcgatgttggcggcgtgatcgac
gagattatggggcatcgtcggtttccgatgattttcgctaatcgctgtggcgcgagcctg
gcgacgatcgccgccgccctgcgccatcgtccggacgccaaagtgatctggtgtgacgcg
catggtgatttcaatacgccagcctcgacgccgactggctatctcggcggcatggtgctg
acagctctctgcggcctgtgggactctggattgggcaccggtctttctgcggatcgcatc
attctcgtgggccaaagggatattgatcccggcgagcaggctttgatcgatcaccatggc
gtcacattattgaccgcgcataagggacatattgaccatcaagccttgctcgatgccata
ggcggcgcgcccgtatggtttcacattgataccgatgtcatcgaccctctctatcttccg
gccgaatatcgggtcgatgcgggtctgtctccgcaagcggttcaggacatgctcgcgacg
attgtcgaggccgtcgaactggtcggctttgaaatgacggaattcgaagcgccgccaacg
cgcgaattacgcgagcctatcatcgaggccatcatgactatgttgagcccgctctggatc
gcgaacctctga

DBGET integrated database retrieval system