KEGG   Beijerinckia indica: Bind_2915Help
Entry
Bind_2915         CDS       T00688                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bid  Beijerinckia indica
Pathway
bid00010  Glycolysis / Gluconeogenesis
bid00052  Galactose metabolism
bid00500  Starch and sucrose metabolism
bid00520  Amino sugar and nucleotide sugar metabolism
bid00521  Streptomycin biosynthesis
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_2915
   00052 Galactose metabolism
    Bind_2915
   00500 Starch and sucrose metabolism
    Bind_2915
   00520 Amino sugar and nucleotide sugar metabolism
    Bind_2915
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bind_2915
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bind_2915
Enzymes [BR:bid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bind_2915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACB96483
UniProt: B2IKK3
Position
complement(3319355..3320359)
Genome map
AA seq 334 aa AA seqDB search
MHFPFPHLLADIGGTNVRFAIVDRPGGELRTGFAGKTGAFFNFEAALAVALEDFAVQPRS
LIACAAGPVQNRCVQMTNAHWRIDGAAVAPLFGLEQGLLLNDFEAQAYSLAVLRPDLIHP
IGAQGEKLAGAQVILGPGTGLGVAALVMVKDAYYALVSEAGHVDFGPASDEEAALWPYID
REPLGRISAESLLSGPGLLRLHRARLTMVKHPPEKAIQDVGVLIEQAHKNEVGEEAATVR
LFLSLLARFSSDMAVTFVSRGGVTFAGGILPRLIDFLDVATFRTHFENKPPHKAWVSQIP
TRLIMDEAALFQGLAAIGAKPELYLINYAKRAWC
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcattttccctttccccatctcctggctgatattggtggaaccaatgtccgtttcgcc
atagttgatcggccgggcggcgaattacggacgggatttgccggcaagacgggggctttc
ttcaattttgaggcagccttggccgtggctttggaggattttgccgttcaaccacgctcg
cttatcgcctgcgccgccgggccggtccagaaccggtgtgttcagatgaccaatgcccat
tggaggatcgatggggcggcggtcgcgcctctcttcggcttggagcaggggttgctcctg
aatgatttcgaggcgcaggcctatagtctggcggttttacgcccagacctcatccatccg
atcggcgcgcaaggagagaagctagcaggtgctcaggtgatcctgggaccggggaccggg
ctgggcgttgcggctttggtgatggtcaaggatgcttattatgccttggtaagcgaggcg
ggacatgtggatttcgggccggcgagcgacgaggaagccgcgctctggccgtacatcgat
cgggaaccacttgggcgcatcagcgcggaaagccttctttctgggcctggtctcttgcgt
ttgcatcgggcgcggctcaccatggtgaaacatccaccggagaaggcgatacaggatgtc
ggggtgctgatcgaacaggctcataagaatgaggtgggagaagaagctgcgacggtccgc
cttttcctatcgctgctggcgcgcttcagcagcgatatggcggtgactttcgtctcgcgg
ggaggagtgactttcgcgggtggaatcttgccacgattgatcgattttctcgatgtcgcg
acattcaggacccatttcgagaacaagcccccgcataaagcctgggtcagtcagattccc
acgcgcctgatcatggacgaggcggctttgtttcagggattggcggcgattggggcgaag
ccagaactctatctgatcaattatgcaaaacgcgcctggtgctga

DBGET integrated database retrieval system