KEGG   Beijerinckia indica: Bind_3029Help
Entry
Bind_3029         CDS       T00688                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bid  Beijerinckia indica
Pathway
bid00260  Glycine, serine and threonine metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
bid01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bind_3029
Enzymes [BR:bid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Bind_3029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DUF3920
Motif
Other DBs
NCBI-ProteinID: ACB96591
UniProt: B2IBG5
Position
complement(3447401..3448474)
Genome map
AA seq 357 aa AA seqDB search
MEFSSDNTAGASQPILEAIIAANDGHAAPYGADTLSLEAERRLAVVFEHELACFLVPTGT
AANALALGALCPPWGAVFCHEDAHVIADECGAPEMFTAGGKLVGIEGVRAKITPEAFTAK
LAAFPRGPVRQVQPAALSLSQVTEAGTLYRPAEISALSEIAHAAGLAVHMDGARFANALV
ALGCTPAEMTWKAGIDVLSFGATKNGAWACEAVLFFDPEKARDFIYRRKRGGHTVSKSRL
LGAQMTAYLDQDHWLDLARIANARARRLAEGIARIPGLRLAWPCEANEVFVVLSEEVDKV
LQKAGGHYYTWDKPGLMEGPPVGPTEVLARLVTSFATKDEAIDQFLAVAAAAAQKHA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcaagcgataatacggccggggcgagccagcccattctcgaggcgatcatc
gcggccaatgatggtcatgccgccccctatggagcggacactctaagccttgaggccgaa
cgccgtcttgccgtggttttcgagcatgagcttgcctgttttctggtgccgaccggcacg
gccgccaatgctttggcgctcggcgcgctctgtccgccctggggcgctgtcttctgccac
gaggacgcccatgtgattgccgatgaatgcggcgcgccggaaatgttcacagccggtggc
aagcttgtcggcatcgagggcgtgcgtgccaagatcacaccggaagccttcaccgccaag
ctcgccgctttcccgcgggggccagtcaggcaggtgcagccggcggccttgtccctgtcg
caagtgaccgaagccggcacgctttaccgaccagcggaaatctctgccttgagcgaaatc
gctcatgcggcggggcttgccgtgcatatggatggagcccgtttcgccaatgcgctcgtc
gcgcttggctgcacgcccgccgaaatgacctggaaggcgggcattgatgtgctctccttc
ggcgccaccaagaatggcgcttgggcctgcgaggcggtcttgttcttcgatcccgaaaaa
gcgcgcgacttcatctatcgccgcaagcgcggtggtcataccgtctccaaaagccggctg
ctgggtgcgcagatgacggcttatctcgaccaggatcattggctggacctggcgagaatc
gccaatgcccgtgcgcgccggcttgctgaagggatcgcgcgcattccgggactgcggctc
gcctggccctgcgaggccaatgaggttttcgtggttctttccgaagaggttgacaaggtt
ttgcagaaggccgggggacattattatacttgggataagccgggcctgatggaggggccg
ccggtcggtcccacggaagtcctcgcgcgtctcgtgacctcctttgcgaccaaggatgag
gcgatcgaccaattcctggctgtcgcggcggcggcagcacagaaacatgcctga

DBGET integrated database retrieval system