KEGG   Beijerinckia indica: Bind_3076Help
Entry
Bind_3076         CDS       T00688                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bid  Beijerinckia indica
Pathway
bid00010  Glycolysis / Gluconeogenesis
bid00052  Galactose metabolism
bid01100  Metabolic pathways
bid01110  Biosynthesis of secondary metabolites
bid01120  Microbial metabolism in diverse environments
bid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bind_3076
   00052 Galactose metabolism
    Bind_3076
Enzymes [BR:bid01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bind_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACB96637
UniProt: B2IBL1
Position
complement(3512645..3513733)
Genome map
AA seq 362 aa AA seqDB search
MTYIETVGPNIVREHFGHLPDGATVERVRLCGRNGFELAVITFGATVQSLHVPDRTGRCA
DIVLGHDDFAPYFAHRRYFGATIGRYANRIAHGSFLLDGRRFQVTANDGVNSLHGGVAGF
DQRLWSIEALTDDPAPSMTLAYISPDGEEGYPGTLSARVTYTVTEDIGFSIAFEAMTDRP
TVVNLTHHGFFNLAGVDAAEDVLDHELLMMADAYLPVDETLIPLGGPEPVVGTPFDFRQP
QRIGARLRNGHEQLRLAQGYDHNFCLQGGRTEAPRLAARVLHRASGRGMELFTDQPGLQF
YSGNFLDGSVPGKRGRLYRQADAFCLEPQAWPDAPNRLDYSSVRLDPGEVYRHLSFYRFY
ST
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacatacatcgaaacagtgggtccgaacatcgtgcgcgagcacttcggtcatctgccg
gacggagccactgttgagcgtgtgcggctctgtggcagaaacggcttcgaactcgccgtc
attacttttggtgccactgtccaatcccttcacgtgccagaccgtacaggacgttgcgcc
gacatcgtgcttggtcatgacgattttgcgccttatttcgcgcatcgacgctatttcggc
gccactatcggtcgctatgctaaccgtatcgcgcacggcagctttttactcgatggccgg
cgattccaggtgacggccaatgatggggtgaacagtctgcatggcggtgtagccgggttc
gaccagcggctatggtctatcgaggcccttacggatgatcccgcgccctcgatgacattg
gcctatatcagccccgatggagaagaaggctatcctggcacactcagcgcccgcgtcact
tataccgtgaccgaggatattgggttctccatcgccttcgaggcgatgaccgatcgaccc
accgtcgtcaacctcacgcaccacggattcttcaatctcgccggcgttgatgcggcagaa
gatgtgctcgaccatgagctcctcatgatggcggatgcctatctgcctgttgatgagacc
ctgattccgcttggcgggccggagcctgttgtgggcactccgttcgatttccgtcagccg
cagcggattggcgcgcgcctacgaaacggacacgagcagcttcgtcttgcgcagggctac
gaccacaatttttgcctccaaggcggccggaccgaggcaccgcggctcgccgcccgagtc
ctgcatcgcgcgtccggcagagggatggagcttttcaccgatcagcccggtctccaattc
tattccggcaatttccttgacgggtcggtgccgggaaaacgcggccgcctctatcggcaa
gccgatgccttttgccttgagccacaagcttggcctgatgcgcccaatcggctggactac
tcctccgtcagactcgatccaggcgaagtttaccggcacctttccttctaccgtttttac
tcaacctga

DBGET integrated database retrieval system