KEGG   Beijerinckia indica: Bind_3078Help
Entry
Bind_3078         CDS       T00688                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
bid  Beijerinckia indica
Pathway
bid00040  Pentose and glucuronate interconversions
bid00053  Ascorbate and aldarate metabolism
bid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bind_3078
   00053 Ascorbate and aldarate metabolism
    Bind_3078
Enzymes [BR:bid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Bind_3078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ACB96639
UniProt: B2IBL3
Position
complement(3514704..3516290)
Genome map
AA seq 528 aa AA seqDB search
MAIKGESLIGSRDVSTVQTFHAVNPATGLTIEPPFAEAGEADVEAAAQLAAEAFPIFRET
TPSARAAFLEAIADAIEAIGDELIDRAMQETGLPKARLTGERGRTTGQLRLFSTVLRRGD
WVDARIDPALPKREPLPRSDLRMRQIGVGPVAVFGASNFPLAFSVAGGDTASALAAGCPV
VVKGHPAHPGTSELVGRAVRSAVEASGLPEGVFSLLSGTSHTLGTSLVADPRIMAVGFTG
SRGGGLALSRIAAQRPVPIPVYAEMSSINPVFLLPGALAARADQLGTAFVGSLTLGAGQF
CTNPGVAIGIAGVDFDRFIAAAAVALGGAPAAAMLTPGIADAYQRGVDALAAQAAVEELA
RGTVPNGPNACRPALFTTDAKAFCATSELSHEVFGASSLIVRCADKEEMQAVARALEGQL
TATLHLESGDETLARTLLPVLDEKAGRILANGWPTGVEVCDAMVHGGPFPATSDPRTTSV
GTLAIRRFLRPVCYQDLPPALLPPALQPDNPLGLPRLVNGKTELGGAP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcgataaaaggagagagcctgatcgggagccgcgacgtgtcgacagtacagaccttc
cacgccgtcaatcccgcgaccggcctcacgatcgagccgcccttcgccgaagcaggagag
gcggacgtcgaggccgccgcgcaactcgcagcggaagccttcccgatcttccgcgagacc
acgccatcggcgcgcgcggctttccttgaggctatcgccgatgcgatcgaggcgatcggg
gatgagctgatcgaccgtgccatgcaggaaaccgggctgcctaaggctcgcctcaccggc
gagcgcgggcggaccacggggcaactccggctattcagcacggttcttcggcgcggcgac
tgggtcgatgcgcgcatcgatcccgctttgcccaaacgcgaacctttgccgcgctccgac
cttcgaatgcgacagatcggcgtcggtccggtggccgtcttcggcgcaagcaacttcccg
cttgccttctcggtggcagggggtgacacggcttcggcgctggccgctggctgcccggtg
gtggtgaaaggccatcccgctcatcccggcacttcggaactggtcggccgcgccgtaaga
tcggctgtagaggcctcgggcctaccggaaggcgtcttctccctgctttcgggcaccagc
catacactcggaacctcgttggtcgcggatccgcgcatcatggccgtcggctttacgggc
tcaaggggcggcggccttgcgctctcgcgtattgccgcgcagcgcccggtgccgatcccg
gtctatgcggagatgagcagcatcaatcctgtgtttctgctgcccggcgcgctcgctgca
agagccgatcaactcggcaccgccttcgtcggatcccttacgctgggggcgggccaattc
tgtaccaatcccggcgtggcgatcggcatcgccggcgtggatttcgaccgtttcatcgcc
gctgccgctgtggctttgggaggagcccccgcagccgctatgctgacacccggcatcgct
gacgcctatcagcggggcgttgacgcgctggctgctcaagcggcggtggaggaactggcc
cggggcactgttccgaatggccccaacgcttgcaggccggccctgttcacgaccgacgcc
aaagccttctgcgccacatccgagttgtcacatgaagtcttcggcgcctcatcgctgatc
gtgcgctgcgccgataaggaagagatgcaagccgtcgcccgtgcgctcgaaggacaactc
acggcgactcttcatctcgaatctggcgacgaaacgcttgctcgcacacttttgccagta
ctggacgaaaaagcgggacgcattctcgccaatggctggcccacaggcgtggaagtctgt
gatgccatggtgcatggggggccgttcccagccacgtccgatccgcgaacgacatcggtg
gggacgctggccattcgccgcttcctgagacctgtctgttaccaggacctgccaccggcc
ttgctgccgccagccctgcagcccgacaatcctcttggcttgccccggcttgtcaatgga
aagaccgagctcggaggggcgccatga

DBGET integrated database retrieval system