KEGG   Bacillus infantis: N288_00770Help
Entry
N288_00770        CDS       T02860                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bif  Bacillus infantis
Pathway
bif03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bif00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    N288_00770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bif03011]
    N288_00770
Ribosome [BR:bif03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    N288_00770
  Bacteria
    N288_00770
  Archaea
    N288_00770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 TINF2_N DUF3234
Motif
Other DBs
NCBI-ProteinID: AGX01970
UniProt: U5L4B1
Position
144206..144547
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVVDLIRGKQVGEAVAILNHTPKAASPVVEKLLKSALANAEH
NYEMDVNNLVVSQVFVDEGPTLKRFRPRAMGRASAINKRTSHITIVLSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagttcgtattgctcctcgtaaagctcgtttagtc
gtagatttaattcgaggtaagcaagtaggtgaagcggtggctatcttaaaccatacgcca
aaagcagcttctcctgtcgttgaaaaattattgaaatccgcattggcaaatgctgagcat
aactacgaaatggacgtaaacaatttagtagtatctcaagtattcgttgacgagggacca
actttgaagcgtttccgtccgcgtgctatgggccgtgcaagtgcaatcaacaaacgtact
agtcatattactatcgttttatcagaaaagaaggagggataa

DBGET integrated database retrieval system