KEGG   Bacillus infantis: N288_03165Help
Entry
N288_03165        CDS       T02860                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bif  Bacillus infantis
Pathway
bif00010  Glycolysis / Gluconeogenesis
bif00071  Fatty acid degradation
bif00350  Tyrosine metabolism
bif00625  Chloroalkane and chloroalkene degradation
bif00626  Naphthalene degradation
bif00680  Methane metabolism
bif01100  Metabolic pathways
bif01110  Biosynthesis of secondary metabolites
bif01120  Microbial metabolism in diverse environments
bif01200  Carbon metabolism
bif01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    N288_03165
  09102 Energy metabolism
   00680 Methane metabolism
    N288_03165
  09103 Lipid metabolism
   00071 Fatty acid degradation
    N288_03165
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    N288_03165
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    N288_03165
   00626 Naphthalene degradation
    N288_03165
Enzymes [BR:bif01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     N288_03165
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     N288_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGX02596
UniProt: U5L748
Position
551612..552745
Genome map
AA seq 377 aa AA seqDB search
MKAVTYQGSKDIQVKEVEDPRIEKNDDVIVKITSTAICGSDLHIYQGNMPLREGYIIGHE
PMGIVEEVGPEVTKVKKGDRVVIPFNVSCGQCFFCQHDMESQCDNSNPHQDTGAYFGYTE
RYGNYPGGQAEYLRVPYGNFVPFVVPESNEMEDEELLFLSDVLPTAYWSVLHSGVKKGDT
VVVLGCGPIGLMAQKFAWMKGASRVIAVDHLDYRLQHAKLVNKVETFNFSEHDDMGDYLK
EITSGGAEVVIDCVGMDGKKSAIEKIEQKLKLQGGTLGPIQMATKAVKKFGTVQLTGVYG
ATYNMFPLEAFFSRNVTIKTGQAPVIHLMPEIYNMIEEKKIDPTHIVSHKLPLADAARGY
HLFNEHEDDCTKVVLKP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgtaacttaccaaggttccaaagatattcaagtcaaggaagttgaagatcca
aggattgagaaaaatgatgatgttattgtcaaaataacttccacagcgatttgcgggtca
gatctgcatatctaccagggaaatatgcccctgagggaaggctatattatcggacatgaa
ccgatgggcattgttgaagaggttggccctgaggttacgaaggtgaaaaaaggggacagg
gttgtcattccttttaacgtttcctgcgggcagtgcttcttctgccagcatgacatggaa
agccaatgcgataattccaatcctcaccaggatacaggcgcttactttggctatacagaa
agatacggaaactaccctggcggccaggcagagtatctgcgcgtcccttatggaaatttt
gtaccgtttgttgtacccgaatccaatgaaatggaagacgaggagctgctgttcctttcc
gatgttctcccgactgcttattggagcgttcttcattccggcgtcaaaaagggtgacacg
gtcgtcgtcctgggctgcggaccgatcggcttgatggcccagaaattcgcctggatgaaa
ggcgcttcccgagtgattgcagtcgaccatcttgactaccgcctgcagcatgccaagctc
gtcaataaggttgaaaccttcaacttcagtgaacatgatgatatgggtgattatctgaag
gaaatcacaagcggcggtgccgaggttgtcatcgactgcgtcggcatggacgggaagaaa
tcagcgattgaaaaaatcgagcaaaagctgaagcttcagggaggaacactcgggcctatc
cagatggcaacgaaggctgtcaagaaattcggaacagtccagctgaccggcgtttacggt
gcaacctacaatatgttcccgcttgaagctttcttctccaggaacgtaacgattaaaaca
ggacaggcaccagttatccatctgatgccggaaatctataatatgattgaagagaaaaag
attgatccgacccacattgtcagccacaaactgcccctcgcagatgcggcacgcggctac
catctgttcaatgaacatgaagacgattgcacaaaggttgtattgaagccataa

DBGET integrated database retrieval system