KEGG   Bacillus infantis: N288_07505Help
Entry
N288_07505        CDS       T02860                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
bif  Bacillus infantis
Pathway
bif00220  Arginine biosynthesis
bif01100  Metabolic pathways
bif01110  Biosynthesis of secondary metabolites
bif01130  Biosynthesis of antibiotics
bif01230  Biosynthesis of amino acids
Module
bif_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:bif00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    N288_07505
Enzymes [BR:bif01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     N288_07505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AGX03432
UniProt: U5L9X8
Position
1358746..1359702
Genome map
AA seq 318 aa AA seqDB search
MITAQAADKSLDIQGKDFLTLADFSKNTILGLVQKARKMKNASLLGKDSKSLNGKILGMI
FEKPSTRTRVSFEAGMIQLGGSALYLNSNDLQIGRGETVADTAKVLSQYVDAIMIRTFSH
GMVEELALHADIPVINGLTDLYHPCQALADLLTIYEVKGRLEGLKLVYAGDGNNVAHSLM
IAAAKVGMNLTIAAPPGYEPQEKVLALAKQFGKETGAEIEVVNSAIEAAAGADILYTDVW
TSMGQEQENAERLEIFKSYQVNAQLAAAAKQDYTFLHCLPAHRGEEVAADIIDGSHSAVF
QQAGNRLHAQKALLSELL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgataaccgcacaagcagctgataaaagcctcgatatccaggggaaggatttcttgacc
ctggctgatttctctaaaaatacaattctgggtcttgtccagaaggccaggaagatgaag
aatgcctccctgctgggcaaggattccaagtctttgaatggaaagatattgggaatgatt
tttgaaaagccatcaacaagaacgagggtgtcttttgaggctggtatgatccagctcgga
gggagtgccctttatctgaacagcaatgatctgcagattgggcgaggggaaaccgttgca
gatacagcaaaagttctttcccagtatgttgatgcgattatgatcaggaccttttcccat
gggatggttgaggagcttgcactgcatgcagatattccggttatcaacgggctgacggat
ctttaccatccctgccaggcgctggccgacttgctgaccatctatgaagtgaaaggaagg
cttgaaggattaaagcttgtttatgcaggtgatgggaataatgtagcccactccctgatg
attgcagcagccaaggtaggcatgaatctgacaattgcagcaccaccaggatatgaaccc
caggaaaaggtgctggcgctggcaaagcagtttggcaaagaaaccggcgcggaaattgaa
gtagtgaatagtgccattgaagcagctgcaggtgctgacatcctttatactgatgtttgg
accagtatgggccaggaacaggaaaatgccgagcgtcttgagatattcaagtcttaccag
gtaaatgcccagcttgcagcagctgcaaaacaagattataccttcctccattgtctcccg
gcgcacagaggtgaggaagttgctgcagatataatcgatggcagccattctgctgtattc
cagcaggcggggaaccgtctccacgcccagaaggcgctgctctcagagctcttataa

DBGET integrated database retrieval system