KEGG   Bacillus infantis: N288_22885Help
Entry
N288_22885        CDS       T02860                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
bif  Bacillus infantis
Pathway
bif00520  Amino sugar and nucleotide sugar metabolism
bif01100  Metabolic pathways
bif01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bif00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    N288_22885
Enzymes [BR:bif01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     N288_22885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGX06416
UniProt: U5LIA3
Position
complement(4262339..4263502)
Genome map
AA seq 387 aa AA seqDB search
MEDNYYTLEGMHYKDNKPVRIIIKDGFIESMEPLAALEDSELYIAPGFVDLQVNGYRGVD
FNSIELTVDDVRKACLFLLEEGATSFFPTIITNSFNQIASLTSTISLAREQDELVRSMIP
GIHLEGPFLSGEDGPRGAHSKQYIQPPDFEFFQALNESVNGLIKMITLSPEWPDAADFIK
KAAAHQVLVSIGHTAADGEQIREAVKAGAALSTHLGNGAHVMLPRHPNYLWDQLAEDSLA
ATVICDGYHLPSSVLKVIEKVKEDKMLIISDSVALAGLPPGDYTAPVGGEVTLTEQGKLH
LKNEPKLLAGSAQSILWGVNTLTSMGITALEKAIEKASILPAKLLNLPQKDGLQAGAPAD
LLLFRKENGRMELIKAIKMGDPGPINQ
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaagataattattatacgctggagggcatgcactataaggataataagccagtaaga
atcatcatcaaagatggcttcatcgaatcaatggaacccttggctgcgttggaggattct
gagctttatatagctcccggatttgtagacctccaggtgaatggctacaggggtgttgat
tttaatagcattgaactcaccgtggatgatgtaaggaaggcctgcttgtttcttttggag
gaaggggctacttccttttttcctacgattattacaaactcttttaatcaaattgcatcg
ctcacgtctaccatttcacttgcacgggagcaagatgaactggtgagaagcatgataccg
ggaatccatttggaaggaccgttcctatcaggggaggatggcccaagaggggcacacagc
aaacaatatattcagcctcccgactttgagtttttccaggcactgaatgaatcagtcaat
gggctgatcaaaatgattacactgtcacctgaatggccggatgcggcggactttatcaag
aaggcagcagcacatcaagtgctggtgtctatcggccacacagcggccgatggggaacag
atcagggaggcggttaaagcgggagcagcactatcaacgcacctcggcaacggcgcccat
gtgatgctcccgaggcatccaaactatctatgggatcagctggcggaggattcacttgca
gcaacagtcatttgtgatggctaccatttgccatcttcggttttaaaagtgattgagaag
gtaaaggaagacaaaatgctgatcattagtgacagcgtggcattagccggtctccccccg
ggtgattatacagctcccgtgggaggggaagttaccttaacggaacaaggaaagctgcat
ttgaagaatgaaccgaaactgctggcgggctctgcccaaagcatactttggggagtcaat
actctaacatccatgggcataacagctttggaaaaagccattgaaaaagcttctatcctg
cctgcaaagctgctgaaccttccgcagaaagacggtctgcaggcaggtgcaccggcagat
ctcctcttgtttcgcaaagaaaacggccgtatggagttaattaaggcaataaaaatgggg
gatccgggtcccataaatcaatga

DBGET integrated database retrieval system