KEGG   Bifidobacterium indicum: BINDI_0030Help
Entry
BINDI_0030        CDS       T03564                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bii  Bifidobacterium indicum
Pathway
bii00620  Pyruvate metabolism
bii00680  Methane metabolism
bii01100  Metabolic pathways
bii01120  Microbial metabolism in diverse environments
bii01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bii00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BINDI_0030
  09102 Energy metabolism
   00680 Methane metabolism
    BINDI_0030
Enzymes [BR:bii01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BINDI_0030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIC91316
UniProt: A0A087VSJ0
Position
complement(73601..76360)
Genome map
AA seq 919 aa AA seqDB search
MTDSNQQITAADATLVASGTGTKGPEERDLPQSLGEDMALCLRLLRDVLGEFDKELLNRF
DSLREDVVAASADHFNRHPSDPLPDEDGLAKAVALIDDTSIQDSQLLARALTTYFHLANL
CEENYRVRVLHEREGKIDLGVKGTDPINEMTSAYSQLLQEMGPAKASELLEKLEFHPVFT
AHPTEARRKAVEGKIRRIANLLAVRRGLGGSERVENERLLHNEIDALFRTSPIATKKPTP
VEESNTILDIFDATLFQTIPRVYRRFDDWMLGKKAGTVKPVCPAFFHPGSWIGSDRDGNP
NVTAKVSRKVARKFSDHVLKALQEATSTVGRNMTMEATTTPPSSELRSLWSHQKEMSERL
TDRAEVVSHRELHRAVVLVIADRLTATIKRDADLMYRSCDDFIADLKIVQDSLAAAGAVR
QAYGPLQDLIWQAQTFGFHMVEMEFRQHSLVHARALEDIREHGLHGERGELQPMTHEVLD
TFRALGAIQKRNGQKAARRYIISFTKSAQNVKDVYELNRLAFEHAEDVPVIDVIPLFEQL
EDLQNSVDVLEEIIKIPEVQARLKKTGNKMEVMLGYSDSSKDAGPVSATLALHSAQERIA
KWAESHDIDVTLFHGRGGAVGRGGGPANRAVLAQPVGSVNCRFKLTEQGEVIFARYGNPV
LAIRHIESVAAATLLQSAPSVEERNTTMTEKYSDMAAKLDDSAHRRFLDLLHTPDFAPWF
SIVTPLNEIGLLPIGSRPAKRGLGAKSLDDLRTIPWVFSWAQARINLAAWYGLGTACEEF
NDLDTLRQAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLSLGDRDDLSQKVLSEMELTRK
WVLQIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVRALRTLRRRNDKEELSKSQQADF
IYLILCTVSGVAAGLQNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagtaatcagcaaatcacggcggcggatgcgaccctggttgcgtccggtacc
ggcacaaaaggcccggaggagcgcgatcttccccaatcactgggtgaggatatggcattg
tgcctgcgactgcttcgggatgttctgggggaattcgacaaggaactgctcaaccggttt
gactcgctgcgcgaagatgtggtggcggccagtgccgaccatttcaacagacacccctcc
gaccccctccccgacgaggacggtctggccaaggcggtcgccctgattgacgacacatcc
atacaggactcccaactcctggcccgggctctgactacatacttccacctggccaacctc
tgcgaggagaactaccgggtgcgcgtcctgcatgagcgcgaaggaaagatcgacctgggt
gtcaagggcaccgaccccatcaacgaaatgaccagcgcctacagccaactccttcaggag
atgggtccggccaaggcctcggaactgctggaaaaactggagttccacccggtattcacc
gcccatcccaccgaggcgcgacgcaaggccgtcgagggcaagatacgccgcatcgccaac
ctgctggccgttcgccgtggactgggtggttccgagcgggtggaaaacgagcgtctgctc
cacaacgagatcgacgccctcttccgcacctcccccatcgcgaccaagaagccgacgccc
gtggaggaatccaacaccatcctcgacatcttcgatgccaccctcttccagaccatcccc
agggtctaccgcaggttcgacgactggatgctgggcaagaaggccggtacggtcaagccc
gtctgccccgccttcttccaccccggcagctggataggctccgacagggacggtaatccg
aacgtcaccgccaaggtctcgcgcaaggtggcccgcaagttctccgaccacgtgctcaag
gccctccaggaggcaacctccaccgtcggccgcaacatgactatggaggcgaccaccacc
ccgcccagcagcgaactgcgaagcctgtggagccaccagaaggaaatgagcgagcgcctg
accgaccgcgccgaggtcgtctcccacagggagttgcaccgggccgtggtcctggtcatc
gccgacaggctcaccgccaccatcaagcgtgacgccgacctgatgtaccgcagctgcgac
gatttcatcgccgacctgaagattgttcaggactctctggccgcagccggggccgtccgc
caggcctacggccccctccaggacctgatatggcaggcccagaccttcggtttccacatg
gtcgagatggagttccgtcagcactcactggtccacgcccgcgccctggaggacatccgc
gagcacggcctgcacggcgagcggggagaattgcagcccatgacccacgaggtgctcgac
accttccgtgccctgggtgccattcagaagcgcaacgggcagaaggcggcccgccgctac
atcatctccttcaccaagtcggcccagaacgtcaaggacgtctatgaactgaaccgcctg
gcctttgagcatgccgaggacgttcccgtcatcgacgtgatccccctgttcgagcagctg
gaggatctgcagaactcggtggacgtgctggaggagatcatcaagattcccgaggtccag
gcccgtctcaagaaaaccggcaacaagatggaggtcatgctggggtactccgactcctcc
aaggatgccggacccgtatcggccaccctggccctgcactccgctcaggagcgtatcgcc
aagtgggccgagagccatgacatcgacgtgaccctcttccacggccgcggcggtgccgtg
ggccgtggcggcggcccggccaacagggccgtcctggcccagccggtgggttccgtgaac
tgccgcttcaagctcaccgagcagggcgaggtgattttcgcccgctacggcaacccggtt
ctggccatccgccacatcgagtccgttgccgcagccaccctgctccagtcggcccctagc
gtcgaagagcgcaatacgaccatgacggagaagtactctgacatggccgccaagctggac
gattccgcccaccggcgcttcctggacctcctccacacccccgacttcgctccctggttc
tccatcgtgacgcctctgaacgaaatcggcctcctccccattggttcccgccccgccaag
cgtggtctgggagccaagtccctggatgatttgcggaccataccctgggtcttctcctgg
gcacaggcccgcatcaacctggccgcctggtacggcctgggaacggcctgcgaggagttc
aacgacctggataccctgcgccaggcctacgaggaatggcccctcttcagcaccttcatc
gacaacatcgaaatgagcctggccaagaccgacgagcgcatcgccaagatgtacctgtcc
ctgggcgatcgtgatgacctgagtcagaaagtcctttcggagatggagctgacccgcaag
tgggtcctgcaaatcgtcggcgacgagtggcccctacagcatcgccacgtgctgggccag
gctatccgtatccgctctccctatgtggatgccctatcggtcacccaggtacgcgccctg
cgaaccctgcggcggcgcaacgacaaggaggagctcagcaagagccagcaggcggacttc
atctacctgattctctgcaccgtttcgggagtcgccgctggcctccagaacactggctga

DBGET integrated database retrieval system