KEGG   Bombus impatiens (common eastern bumble bee): 100740409Help
Entry
100740409         CDS       T04362                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase isoform X1
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
bim  Bombus impatiens (common eastern bumble bee)
Pathway
bim00601  Glycosphingolipid biosynthesis - lacto and neolacto series
bim00603  Glycosphingolipid biosynthesis - globo and isoglobo series
bim01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bim00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100740409
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100740409
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bim01003]
    100740409
Enzymes [BR:bim01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     100740409
Glycosyltransferases [BR:bim01003]
 Glycan extension
  P blood group
   100740409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug TcdA_TcdB Caps_synth
Motif
Other DBs
NCBI-GeneID: 100740409
NCBI-ProteinID: XP_012238365
Position
Unknown
AA seq 350 aa AA seqDB search
MKKRFVLGFLCTIVIFILMISTDNGFIQHISPFVIGVWNDITCYEEEGAPDGLPDFDPQL
DKPMTDRNIFFHETSCFDKDGLVLNARQACAVESAAKMNPSMNVYLLFISPSKISDQSRE
MFNQLQTYSNVRIRHIKPEKYMRDTPLHLWYSSGILKKSYWPRSHMSDILRYLTLWKYGG
IYLDLDVVVIASLERLTNFAGAEDWKNVAAGVMGFDVTELGRRMADACIRDMRANFRGDV
WGNNGPGVITRTLQKLCSTKYVRDMTTSRCHGFKVFSPSTFYPIHYEKWKIYFETKDKNT
TMQIVDKAMTIHVWNKFSKFEKVDVNNDVPYVIIARKHCPKIFNNCGKIF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaggtttgtcctcggcttcctgtgcaccatcgtaattttcatcctgatgatt
tccaccgataacggtttcattcaacacatatcaccgttcgtgattggtgtttggaacgac
atcacgtgttacgaagaagaaggcgcgccggatggccttccggattttgatccgcagtta
gataaaccaatgacggatagaaatatcttcttccacgagacatcctgcttcgacaaagat
ggtttggtgctgaacgctcgtcaagcatgtgccgtcgaatccgcggctaaaatgaatcca
agtatgaacgtgtatttgctgtttatctccccttcgaagatttcggatcaatcaagagaa
atgttcaatcaactgcaaacctattcgaacgttcggatcaggcatattaaacctgaaaaa
tacatgagggacacgcctctgcatctatggtatagtagtggcatattgaaaaaaagttat
tggccaagaagtcatatgtcagatattctcagatacctgaccctttggaaatatggagga
atatatttggatctggatgttgttgtcatcgcatccctcgaacgtttaacaaattttgct
ggtgccgaagactggaaaaatgttgctgccggtgttatgggatttgacgttacagagttg
ggtcgtcgtatggcagatgcctgcattcgcgatatgcgagcgaacttccgaggtgacgtc
tggggtaacaatggtcctggtgtgatcactagaacgttgcaaaaactctgttcaactaaa
tacgttcgtgacatgacaacaagtcggtgtcatggctttaaagttttctctccatcgacc
ttttatccgatccactacgagaaatggaagatatattttgaaacaaaggacaagaacaca
acgatgcagatcgtggacaaggcgatgaccattcacgtgtggaataaatttagcaaattc
gaaaaagtggacgtaaataacgatgttccgtacgtgatcatcgcgagaaaacattgtcca
aagatttttaacaattgtggaaagatattttaa

DBGET integrated database retrieval system